pCMV delta R8.2

$193.00

  • Model: PVT11135
  • 50 Units in Stock
Ask a question


Add to Cart:

pCMV delta R8.2


Catalog No. PVT11135
Packing 2ug

 

pCMV delta R8.2  Information

Alias: (Plasmid #12263), pCMV-dR8.2

Promoter: CMV promoter

Replicon: pUC SV40 ori

Plasmid size: 13454bp

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli Stbl3

Culture conditions: LB medium, 37 C

Expression host: mammalian cell 293T

5'sequencing primers: CMV-F

 

pCMV delta R8.2 Description

PCMV Delta R8.2 is a lentiviral packaging plasmid that can provide gag and Pol proteins when lentivirus is packaged.

 

pCMV delta R8.2 Sequence

LOCUS       Exported               13454 bp ds-DNA     circular SYN 16-MAY-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..13454

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        292..621

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      472..607

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     intron          1755..1820

                     /note="small t intron"

                     /note="simian virus 40 (SV40) small t antigen intron"

     CDS             1950..1970

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /note="SV40 NLS"

                     /translation="PKKKRKV"

     enhancer        2420..2799

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        2800..3003

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     CDS             3274..4776

                     /codon_start=1

                     /gene="gag"

                     /product="gag protein from human immunodeficiency virus 1"

                     /note="HIV-1 gag"

                     /translation="MGARASVLSGGELDRWEKIRLRPGGKKKYKLKHIVWASRELERFA

                     VNPGLLETSEGCRQILGQLQPSLQTGSEELRSLYNTVATLYCVHQRIEIKDTKEALDKI

                     EEEQNKSKKKAQQAAADTGHSNQVSQNYPIVQNIQGQMVHQAISPRTLNAWVKVVEEKA

                     FSPEVIPMFSALSEGATPQDLNTMLNTVGGHQAAMQMLKETINEEAAEWDRVHPVHAGP

                     IAPGQMREPRGSDIAGTTSTLQEQIGWMTHNPPIPVGEIYKRWIILGLNKIVRMYSPTS

                     ILDIRQGPKEPFRDYVDRFYKTLRAEQASQEVKNWMTETLLVQNANPDCKTILKALGPG

                     ATLEEMMTACQGVGGPGHKARVLAEAMSQVTNPATIMIQKGNFRNQRKTVKCFNCGKEG

                     HIAKNCRAPRKKGCWKCGKEGHQMKDCTERQANFLGKIWPSHKGRPGNFLQSRPEPTAP

                     PEESFRFGEETTTPSQKQEPIDKELYPLASLRSLFGSDPSSQ"

     CDS             4569..7580

                     /codon_start=1

                     /gene="pol"

                     /product="pol protein from human immunodeficiency virus 1"

                     /note="HIV-1 pol"

                     /translation="FFREDLAFPQGKAREFSSEQTRANSPTRRELQVWGRDNNSLSEAG

                     ADRQGTVSFSFPQITLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMNLPGRWKPKMIG

                     GIGGFIKVRQYDQILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNFPISPIETV

                     PVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPVFAIKKKD

                     STKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKQKKSVTVLDVGDAYFSVPLDKDFRK

                     YTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQCSMTKILEPFRKQNPDIVIYQYMD

                     DLYVGSDLEIGQHRTKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTVQPI

                     VLPEKDSWTVNDIQKLVGKLNWASQIYAGIKVRQLCKLLRGTKALTEVVPLTEEAELEL

                     AENREILKEPVHGVYYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMKGAHT

                     NDVKQLTEAVQKIATESIVIWGKTPKFKLPIQKETWEAWWTEYWQATWIPEWEFVNTPP

                     LVKLWYQLEKEPIIGAETFYVDGAANRETKLGKAGYVTDRGRQKVVPLTDTTNQKTELQ

                     AIHLALQDSGLEVNIVTDSQYALGIIQAQPDKSESELVSQIIEQLIKKEKVYLAWVPAH

                     KGIGGNEQVDKLVSAGIRKVLFLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVA

                     SCDKCQLKGEAMHGQVDCSPGIWQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQET

                     AYFLLKLAGRWPVKTVHTDNGSNFTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNK

                     ELKKIIGQVRDQAEHLKTAVQMAVFIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQK

                     QITKIQNFRVYYRDSRDPVWKGPAKLLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQ

                     MAGDDCVASRQDED"

     misc_feature    7265..7382

                     /note="cPPT/CTS"

                     /note="central polypurine tract and central termination 

                     sequence of HIV-1"

     misc_feature    8951..9184

                     /note="RRE"

                     /note="The Rev response element (RRE) of HIV-1 allows for 

                     Rev-dependent mRNA export from the nucleus to the 

                     cytoplasm."

     promoter        11776..11880

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             11881..12741

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      12912..46

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 gcgtcgattt ttgtgatgct cgtcaggggg gcggagccta tggaaaaacg ccagcaacgc

       61 ggccttttta cggttcctgg ccttttgctg gccttttgct cacatgttct ttcctgcgtt

      121 atcccctgat tctgtggata accgtattac cgcctttgag tgagctgata ccgctcgccg

      181 cagccgaacg accgagcgca gcgagtcagt gagcgaggaa gcggaagagc gcccaatacg

      241 caaaccgcct ctccccgcgc gttggccgat tcattaatgc agctgtggaa tgtgtgtcag

      301 ttagggtgtg gaaagtcccc aggctcccca gcaggcagaa gtatgcaaag catgcatctc

      361 aattagtcag caaccaggtg tggaaagtcc ccaggctccc cagcaggcag aagtatgcaa

      421 agcatgcatc tcaattagtc agcaaccata gtcccgcccc taactccgcc catcccgccc

      481 ctaactccgc ccagttccgc ccattctccg ccccatggct gactaatttt ttttatttat

      541 gcagaggccg aggccgcctc ggcctctgag ctattccaga agtagtgagg aggctttttt

      601 ggaggcctag gcttttgcaa aaagcttgga cacaagacag gcttgcgaga tatgtttgag

      661 aataccactt tatcccgcgt cagggagagg cagtgcgtaa aaagacgcgg actcatgtga

      721 aatactggtt tttagtgcgc cagatctcta taatctcgcg caacctattt tcccctcgaa

      781 cactttttaa gccgtagata aacaggctgg gacacttcac atgagcgaaa aatacatcgt

      841 cacctgggac atgttgcaga tccatgcacg taaactcgca agccgactga tgccttctga

      901 acaatggaaa ggcattattg ccgtaagccg tggcggtctg taccgggtgc gttactggcg

      961 cgtgaactgg gtattcgtca tgtcgatacc gtttgtattt ccagctacga tcacgacaac

     1021 cagcgcgagc ttaaagtgct gaaacgcgca gaaggcgatg gcgaaggctt catcgttatt

     1081 gatgacctgg tggataccgg tggtactgcg gttgcgattc gtgaaatgta tccaaaagcg

     1141 cactttgtca ccatcttcgc aaaaccggct ggtcgtccgc tggttgatga ctatgttgtt

     1201 gatatcccgc aagatacctg gattgaacag ccgtgggata tgggcgtcgt attcgtcccg

     1261 ccaatctccg gtcgctaatc ttttcaacgc ctggcactgc cgggcgttgt tctttttaac

     1321 ttcaggcggg ttacaatagt ttccagtaag tattctggag gctgcatcca tgacacaggc

     1381 aaacctgagc gaaaccctgt tcaaaccccg ctttaaacat cctgaaacct cgacgctagt

     1441 ccgccgcttt aatcacggcg cacaaccgcc tgtgcagtcg gcccttgatg gtaaaaccat

     1501 ccctcactgg tatcgcatga ttaaccgtct gatgtggatc tggcgcggca ttgacccacg

     1561 cgaaatcctc gacgtccagg cacgtattgt gatgagcgat gccgaacgta ccgacgatga

     1621 tttatacgat acggtgattg gctaccgtgg cggcaactgg atttatgagt gggccccgga

     1681 tctttgtgaa ggaaccttac ttctgtggtg tgacataatt ggacaaacta cctacagaga

     1741 tttaaagctc taaggtaaat ataaaatttt taagtgtata atgtgttaaa ctactgattc

     1801 taattgtttg tgtattttag attccaacct atggaactga tgaatgggag cagtggtgga

     1861 atgcctttaa tgaggaaaac ctgttttgct cagaagaaat gccatctagt gatgatgagg

     1921 ctactgctga ctctcaacat tctactcctc caaaaaagaa gagaaaggta gaagacccca

     1981 aggactttcc ttcagaattg ctaagttttt tgagtcatgc tgtgtttagt aatagaactc

     2041 ttgcttgctt tgctatttac accacaaagg aaaaagctgc actgctatac aagaaaatta

     2101 tggaaaaata ttctgtaacc tttataagta ggcataacag ttataatcat aacatactgt

     2161 tttttcttac tccacacagg catagagtgt ctgctattaa taactatgct caaaaattgt

     2221 gtacctttag ctttttaatt tgtaaagggg ttaataagga atatttgatg tatagtgcct

     2281 tgactagaga tcataatcag ccataccaca tttgtagagg ttttacttgc tttaaaaaac

     2341 ctcccacacc tccccctgaa cctgaaacat aaaatgaatg caattgttgt tgttgggctg

     2401 caggaattcg agctcgcccg acattgatta ttgactagtt attaatagta atcaattacg

     2461 gggtcattag ttcatagccc atatatggag ttccgcgtta cataacttac ggtaaatggc

     2521 ccgcctggct gaccgcccaa cgacccccgc ccattgacgt caataatgac gtatgttccc

     2581 atagtaacgc caatagggac tttccattga cgtcaatggg tggagtattt acggtaaact

     2641 gcccacttgg cagtacatca agtgtatcat atgccaagta cgccccctat tgacgtcaat

     2701 gacggtaaat ggcccgcctg gcattatgcc cagtacatga ccttatggga ctttcctact

     2761 tggcagtaca tctacgtatt agtcatcgct attaccatgg tgatgcggtt ttggcagtac

     2821 atcaatgggc gtggatagcg gtttgactca cggggatttc caagtctcca ccccattgac

     2881 gtcaatggga gtttgttttg gcaccaaaat caacgggact ttccaaaatg tcgtaacaac

     2941 tccgccccat tgacgcaaat gggcggtagg cgtgtacggt gggaggtcta tataagcaga

     3001 gctcgtttag tgaaccgtca gatcgcctgg agacgccatc cacgctgttt tgacctccat

     3061 agaagacacc gggaccgatc cagcctccgc ggccgggaac ggtgcattgg aacgcggatt

     3121 ccccgtgcca agagtgacgt aagtaccgcc tatagagtct ataggcccac ccccttggct

     3181 tcttatgcga cggatcgatc ccgtaataag cttcgaggtc cgcggccgcg ttgacgcgca

     3241 cggcaagagg cgaggggcgg cgactggtga gagatgggtg cgagagcgtc agtattaagc

     3301 gggggagaat tagatcgatg ggaaaaaatt cggttaaggc cagggggaaa gaaaaaatat

     3361 aaattaaaac atatagtatg ggcaagcagg gagctagaac gattcgcagt taatcctggc

     3421 ctgttagaaa catcagaagg ctgtagacaa atactgggac agctacaacc atcccttcag

     3481 acaggatcag aagaacttag atcattatat aatacagtag caaccctcta ttgtgtgcat

     3541 caaaggatag agataaaaga caccaaggaa gctttagaca agatagagga agagcaaaac

     3601 aaaagtaaga aaaaagcaca gcaagcagca gctgacacag gacacagcaa tcaggtcagc

     3661 caaaattacc ctatagtgca gaacatccag gggcaaatgg tacatcaggc catatcacct

     3721 agaactttaa atgcatgggt aaaagtagta gaagagaagg ctttcagccc agaagtgata

     3781 cccatgtttt cagcattatc agaaggagcc accccacaag atttaaacac catgctaaac

     3841 acagtggggg gacatcaagc agccatgcaa atgttaaaag agaccatcaa tgaggaagct

     3901 gcagaatggg atagagtgca tccagtgcat gcagggccta ttgcaccagg ccagatgaga

     3961 gaaccaaggg gaagtgacat agcaggaact actagtaccc ttcaggaaca aataggatgg

     4021 atgacacata atccacctat cccagtagga gaaatctata aaagatggat aatcctggga

     4081 ttaaataaaa tagtaagaat gtatagccct accagcattc tggacataag acaaggacca

     4141 aaggaaccct ttagagacta tgtagaccga ttctataaaa ctctaagagc cgagcaagct

     4201 tcacaagagg taaaaaattg gatgacagaa accttgttgg tccaaaatgc gaacccagat

     4261 tgtaagacta ttttaaaagc attgggacca ggagcgacac tagaagaaat gatgacagca

     4321 tgtcagggag tggggggacc cggccataaa gcaagagttt tggctgaagc aatgagccaa

     4381 gtaacaaatc cagctaccat aatgatacag aaaggcaatt ttaggaacca aagaaagact

     4441 gttaagtgtt tcaattgtgg caaagaaggg cacatagcca aaaattgcag ggcccctagg

     4501 aaaaagggct gttggaaatg tggaaaggaa ggacaccaaa tgaaagattg tactgagaga

     4561 caggctaatt ttttagggaa gatctggcct tcccacaagg gaaggccagg gaattttctt

     4621 cagagcagac cagagccaac agccccacca gaagagagct tcaggtttgg ggaagagaca

     4681 acaactccct ctcagaagca ggagccgata gacaaggaac tgtatccttt agcttccctc

     4741 agatcactct ttggcagcga cccctcgtca caataaagat aggggggcaa ttaaaggaag

     4801 ctctattaga tacaggagca gatgatacag tattagaaga aatgaatttg ccaggaagat

     4861 ggaaaccaaa aatgataggg ggaattggag gttttatcaa agtaagacag tatgatcaga

     4921 tactcataga aatctgcgga cataaagcta taggtacagt attagtagga cctacacctg

     4981 tcaacataat tggaagaaat ctgttgactc agattggctg cactttaaat tttcccatta

     5041 gtcctattga gactgtacca gtaaaattaa agccaggaat ggatggccca aaagttaaac

     5101 aatggccatt gacagaagaa aaaataaaag cattagtaga aatttgtaca gaaatggaaa

     5161 aggaaggaaa aatttcaaaa attgggcctg aaaatccata caatactcca gtatttgcca

     5221 taaagaaaaa agacagtact aaatggagaa aattagtaga tttcagagaa cttaataaga

     5281 gaactcaaga tttctgggaa gttcaattag gaataccaca tcctgcaggg ttaaaacaga

     5341 aaaaatcagt aacagtactg gatgtgggcg atgcatattt ttcagttccc ttagataaag

     5401 acttcaggaa gtatactgca tttaccatac ctagtataaa caatgagaca ccagggatta

     5461 gatatcagta caatgtgctt ccacagggat ggaaaggatc accagcaata ttccagtgta

     5521 gcatgacaaa aatcttagag ccttttagaa aacaaaatcc agacatagtc atctatcaat

     5581 acatggatga tttgtatgta ggatctgact tagaaatagg gcagcataga acaaaaatag

     5641 aggaactgag acaacatctg ttgaggtggg gatttaccac accagacaaa aaacatcaga

     5701 aagaacctcc attcctttgg atgggttatg aactccatcc tgataaatgg acagtacagc

     5761 ctatagtgct gccagaaaag gacagctgga ctgtcaatga catacagaaa ttagtgggaa

     5821 aattgaattg ggcaagtcag atttatgcag ggattaaagt aaggcaatta tgtaaacttc

     5881 ttaggggaac caaagcacta acagaagtag taccactaac agaagaagca gagctagaac

     5941 tggcagaaaa cagggagatt ctaaaagaac cggtacatgg agtgtattat gacccatcaa

     6001 aagacttaat agcagaaata cagaagcagg ggcaaggcca atggacatat caaatttatc

     6061 aagagccatt taaaaatctg aaaacaggaa agtatgcaag aatgaagggt gcccacacta

     6121 atgatgtgaa acaattaaca gaggcagtac aaaaaatagc cacagaaagc atagtaatat

     6181 ggggaaagac tcctaaattt aaattaccca tacaaaagga aacatgggaa gcatggtgga

     6241 cagagtattg gcaagccacc tggattcctg agtgggagtt tgtcaatacc cctcccttag

     6301 tgaagttatg gtaccagtta gagaaagaac ccataatagg agcagaaact ttctatgtag

     6361 atggggcagc caatagggaa actaaattag gaaaagcagg atatgtaact gacagaggaa

     6421 gacaaaaagt tgtcccccta acggacacaa caaatcagaa gactgagtta caagcaattc

     6481 atctagcttt gcaggattcg ggattagaag taaacatagt gacagactca caatatgcat

     6541 tgggaatcat tcaagcacaa ccagataaga gtgaatcaga gttagtcagt caaataatag

     6601 agcagttaat aaaaaaggaa aaagtctacc tggcatgggt accagcacac aaaggaattg

     6661 gaggaaatga acaagtagat aaattggtca gtgctggaat caggaaagta ctatttttag

     6721 atggaataga taaggcccaa gaagaacatg agaaatatca cagtaattgg agagcaatgg

     6781 ctagtgattt taacctacca cctgtagtag caaaagaaat agtagccagc tgtgataaat

     6841 gtcagctaaa aggggaagcc atgcatggac aagtagactg tagcccagga atatggcagc

     6901 tagattgtac acatttagaa ggaaaagtta tcttggtagc agttcatgta gccagtggat

     6961 atatagaagc agaagtaatt ccagcagaga cagggcaaga aacagcatac ttcctcttaa

     7021 aattagcagg aagatggcca gtaaaaacag tacatacaga caatggcagc aatttcacca

     7081 gtactacagt taaggccgcc tgttggtggg cggggatcaa gcaggaattt ggcattccct

     7141 acaatcccca aagtcaagga gtaatagaat ctatgaataa agaattaaag aaaattatag

     7201 gacaggtaag agatcaggct gaacatctta agacagcagt acaaatggca gtattcatcc

     7261 acaattttaa aagaaaaggg gggattgggg ggtacagtgc aggggaaaga atagtagaca

     7321 taatagcaac agacatacaa actaaagaat tacaaaaaca aattacaaaa attcaaaatt

     7381 ttcgggttta ttacagggac agcagagatc cagtttggaa aggaccagca aagctcctct

     7441 ggaaaggtga aggggcagta gtaatacaag ataatagtga cataaaagta gtgccaagaa

     7501 gaaaagcaaa gatcatcagg gattatggaa aacagatggc aggtgatgat tgtgtggcaa

     7561 gtagacagga tgaggattaa cacatggaaa agattagtaa aacaccatat gtatatttca

     7621 aggaaagcta aggactggtt ttatagacat cactatgaaa gtactaatcc aaaaataagt

     7681 tcagaagtac acatcccact aggggatgct aaattagtaa taacaacata ttggggtctg

     7741 catacaggag aaagagactg gcatttgggt cagggagtct ccatagaatg gaggaaaaag

     7801 agatatagca cacaagtaga ccctgaccta gcagaccaac taattcatct gcactatttt

     7861 gattgttttt cagaatctgc tataagaaat accatattag gacgtatagt tagtcctagg

     7921 tgtgaatatc aagcaggaca taacaaggta ggatctctac agtacttggc actagcagca

     7981 ttaataaaac caaaacagat aaagccacct ttgcctagtg ttaggaaact gacagaggac

     8041 agatggaaca agccccagaa gaccaagggc cacagaggga gccatacaat gaatggacac

     8101 tagagctttt agaggaactt aagagtgaag ctgttagaca ttttcctagg atatggctcc

     8161 ataacttagg acaacatatc tatgaaactt acggggatac ttgggcagga gtggaagcca

     8221 taataagaat tctgcaacaa ctgctgttta tccatttcag aattgggtgt cgacatagca

     8281 gaataggcgt tactcgacag aggagagcaa gaaatggagc cagtagatcc tagactagag

     8341 ccctggaagc atccaggaag tcagcctaaa actgcttgta ccaattgcta ttgtaaaaag

     8401 tgttgctttc attgccaagt ttgtttcatg acaaaagcct taggcatctc ctatggcagg

     8461 aagaagcgga gacagcgacg aagagctcat cagaacagtc agactcatca agcttctcta

     8521 tcaaagcagt aagtagtaca tgtaatgcaa cctataatag tagcaatagt agcattagta

     8581 gtagcaataa taatagcaat agttgtgtgg tccatagtaa tcatagaata taggaaaata

     8641 ttaagacaaa gaaaaataga caggttaatt gatagactaa tagaaagagc agaagacagt

     8701 ggcaatgaga gtgaaggaga agtatcagca cttgtggaga tgggggtgga aatggggcac

     8761 catgctcctt gggatattga tgatctgtag ttgagcggcc gctgatcttc agacctggag

     8821 gaggagatat gagggacaat tggagaagtg aattatataa atataaagta gtaaaaattg

     8881 aaccattagg agtagcaccc accaaggcaa agagaagagt ggtgcagaga gaaaaaagag

     8941 cagtgggaat aggagctttg ttccttgggt tcttgggagc agcaggaagc actatgggcg

     9001 cagcgtcaat gacgctgacg gtacaggcca gacaattatt gtctggtata gtgcagcagc

     9061 agaacaattt gctgagggct attgaggcgc aacagcatct gttgcaactc acagtctggg

     9121 gcatcaagca gctccaggca agaatcctgg ctgtggaaag atacctaaag gatcaacagc

     9181 tcctggggat ttggggttgc tctggaaaac tcatttgcac cactgctgtg ccttggaatg

     9241 ctagttggag taataaatct ctggaacaga tttggaatca cacgacctgg atggagtggg

     9301 acagagaaat taacaattac acaagcttaa tacactcctt aattgaagaa tcgcaaaacc

     9361 agcaagaaaa gaatgaacaa gaattattgg aattagataa atgggcaagt ttgtggaatt

     9421 ggtttaacat aacaaattgg ctgtggtata taaaattatt cataatgata gtaggaggct

     9481 tggtaggttt aagaatagtt tttgctgtac tttctatagt gaatagagtt aggcagggat

     9541 attcaccatt atcgtttcag acccacctcc caaccccgag gggacccgac aggcccgaag

     9601 gaatagaaga agaaggtgga gagagagaca gagacagatc cattcgatta gtgaacggat

     9661 ccttggcact tatctgggac gatctgcgga gcctgtgcct cttcagctac caccgcttga

     9721 gagacttact cttgattgta acgaggattg tggaacttct gggacgcagg gggtgggaag

     9781 ccctcaaata ttggtggaat ctcctacaat attggagtca ggagctaaag aatagtgctg

     9841 ttagcttgct caatgccaca gccatagcag tagctgaggg gacagatagg gttatagaag

     9901 tagtacaagg agcttgtaga gctattcgcc acatacctag aagaataaga cagggcttgg

     9961 aaaggatttt gctataagat gggtggcaag tggtcaaaaa gtagtgtgat tggatggcct

    10021 actgtaaggg aaagaatgag acgagctgag ccagcagcag atggggtggg agcagtatct

    10081 cgagacctag aaaaacatgg agcaatcaca agtagcaata cagcagctac caatgctgat

    10141 tgtgcctggc tagaagcaca agaggaggag gaggtgggtt ttccagtcac acctcaggta

    10201 cctttaagac caatgactta caaggcagct gtagatctta gccacttttt aaaagaaaag

    10261 gggggactgg aagggctaat tcactcccaa cgaagacaag atatccttga tctgtggatc

    10321 taccacacac aaggctactt ccctgattgg cagaactaca caccagggcc agggatcaga

    10381 tatccactga cctttggatg gtgctacaag ctagtaccag ttgagcaaga gaaggtagaa

    10441 gaagccaatg aaggagagaa cacccgcttg ttacaccctg tgagcctgca tgggatggat

    10501 gacccggaga gagaagtatt agagtggagg tttgacagcc gcctagcatt tcatcacatg

    10561 gcccgagagc tgcatccgga gtacttcaag aactgctgag cggccgcccc ggtgaccttc

    10621 agaccttggc actggaggtg gcccggcaga agcgcggcat cgtggatcag tgctgcacca

    10681 gcatctgctc tctctaccaa ctggagaact actgcaacta ggcccaccac taccctgtcc

    10741 acccctctgc aatgaataaa acctttgaaa gagcactaca agttgtgtgt acatgcgtgc

    10801 atgtgcatat gtggtgcggg gggaacatga gtggggctgg ctggagtggc gatgataagc

    10861 tgtcaaacat gagaattctt gaagacgaaa gggcctcgtg atacgcctat ttttataggt

    10921 taatgtcatg ataataatgg tttcttagtc tagaattaat tccgtgtatt ctatagtgtc

    10981 acctaaatcg tatgtgtatg atacataagg ttatgtatta attgtagccg cgttctaacg

    11041 acaatatgta caagcctaat tgtgtagcat ctggcttact gaagcagacc ctatcatctc

    11101 tctcgtaaac tgccgtcaga gtcggtttgg ttggacgaac cttctgagtt tctggtaacg

    11161 ccgtcccgca cccggaaatg gtcagcgaac caatcagcag ggtcatcgct agccagatcc

    11221 tctacgccgg acgcatcgtg gccggcatca ccggcgccac aggtgcggtt gctggcgcct

    11281 atatcgccga catcaccgat ggggaagatc gggctcgcca cttcgggctc atgagcgctt

    11341 gtttcggcgt gggtatggtg gcaggccccg tggccggggg actgttgggc gccatctcct

    11401 tgcatgcacc attccttgcg gcggcggtgc tcaacggcct caacctacta ctgggctgct

    11461 tcctaatgca ggagtcgcat aagggagagc gtcgaatggt gcactctcag tacaatctgc

    11521 tctgatgccg catagttaag ccagccccga cacccgccaa cacccgctga cgcgccctga

    11581 cgggcttgtc tgctcccggc atccgcttac agacaagctg tgaccgtctc cgggagctgc

    11641 atgtgtcaga ggttttcacc gtcatcaccg aaacgcgcga gacgaaaggg cctcgtgata

    11701 cgcctatttt tataggttaa tgtcatgata ataatggttt cttagacgtc aggtggcact

    11761 tttcggggaa atgtgcgcgg aacccctatt tgtttatttt tctaaataca ttcaaatatg

    11821 tatccgctca tgagacaata accctgataa atgcttcaat aatattgaaa aaggaagagt

    11881 atgagtattc aacatttccg tgtcgccctt attccctttt ttgcggcatt ttgccttcct

    11941 gtttttgctc acccagaaac gctggtgaaa gtaaaagatg ctgaagatca gttgggtgca

    12001 cgagtgggtt acatcgaact ggatctcaac agcggtaaga tccttgagag ttttcgcccc

    12061 gaagaacgtt ttccaatgat gagcactttt aaagttctgc tatgtggcgc ggtattatcc

    12121 cgtattgacg ccgggcaaga gcaactcggt cgccgcatac actattctca gaatgacttg

    12181 gttgagtact caccagtcac agaaaagcat cttacggatg gcatgacagt aagagaatta

    12241 tgcagtgctg ccataaccat gagtgataac actgcggcca acttacttct gacaacgatc

    12301 ggaggaccga aggagctaac cgcttttttg cacaacatgg gggatcatgt aactcgcctt

    12361 gatcgttggg aaccggagct gaatgaagcc ataccaaacg acgagcgtga caccacgatg

    12421 cctgtagcaa tggcaacaac gttgcgcaaa ctattaactg gcgaactact tactctagct

    12481 tcccggcaac aattaataga ctggatggag gcggataaag ttgcaggacc acttctgcgc

    12541 tcggcccttc cggctggctg gtttattgct gataaatctg gagccggtga gcgtgggtct

    12601 cgcggtatca ttgcagcact ggggccagat ggtaagccct cccgtatcgt agttatctac

    12661 acgacgggga gtcaggcaac tatggatgaa cgaaatagac agatcgctga gataggtgcc

    12721 tcactgatta agcattggta actgtcagac caagtttact catatatact ttagattgat

    12781 ttaaaacttc atttttaatt taaaaggatc taggtgaaga tcctttttga taatctcatg

    12841 accaaaatcc cttaacgtga gttttcgttc cactgagcgt cagaccccgt agaaaagatc

    12901 aaaggatctt cttgagatcc tttttttctg cgcgtaatct gctgcttgca aacaaaaaaa

    12961 ccaccgctac cagcggtggt ttgtttgccg gatcaagagc taccaactct ttttccgaag

    13021 gtaactggct tcagcagagc gcagatacca aatactgttc ttctagtgta gccgtagtta

    13081 ggccaccact tcaagaactc tgtagcaccg cctacatacc tcgctctgct aatcctgtta

    13141 ccagtggctg ctgccagtgg cgataagtcg tgtcttaccg ggttggactc aagacgatag

    13201 ttaccggata aggcgcagcg gtcgggctga acggggggtt cgtgcacaca gcccagcttg

    13261 gagcgaacga cctacaccga actgagatac ctacagcgtg agctatgaga aagcgccacg

    13321 cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg gcagggtcgg aacaggagag

    13381 cgcacgaggg agcttccagg gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc

    13441 cacctctgac ttga

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart