pCMV- Gluc- 1

$160.00

  • Model: PVT10835
  • 50 Units in Stock
Ask a question


Add to Cart:

pCMV-Gluc-1


Catalog No. PVT10835
Packing 2ug
 

pCMV-Gluc-1 Information

Promoter: CMV

Replicon: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid Classification: Mammalian Cells, Fluorescent Protein Reporting Vectors

Plasmid size: 4693bp

Prokaryotic resistance: Kan

Selection marker: Neo

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, transient expression

5'Sequencing Primers: CMV-F: CGCAAATGGGGGGGTAGGGGGGTG

3'Sequencing Primers: Designing Primers Based on Sequences

 

pCMV-Gluc-1 Multiple cloning sites

pmGeos-M-N1-vector

 

 

pCMV-Gluc-1 Sequence

LOCUS       Exported                4693 bp ds-DNA     circular SYN 29-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled 2

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4693)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Thursday, September 29, 2016 from SnapGene Viewer 3.2.1

            

FEATURES             Location/Qualifiers

     source          1..4693

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        61..364

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        365..568

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     misc_feature    591..671

                     /note="MCS"

                     /note="multiple cloning site"

     CDS             679..1359

                     /codon_start=1

                     /product="monomeric variant of green-to-red photoswitchable

                     fluorescent protein EosFP (McKinney et al., 2009)"

                     /note="mEos2"

                     /translation="MSAIKPDMKIKLRMEGNVNGHHFVIDGDGTGKPFEGKQSMDLEVK

                     EGGPLPFAFDILTTAFMYGNRVFAKYPDNIQDYFKQSFPKGYSWERSLTFEDGGICIAR

                     NDITMEGDTFYNKVRFYGTNFPANGPVMQKKTLKWEPSTEKMYVRDGVLTGDIHMALLL

                     EGNAHYRCDFRTTYKAKEKGVKLPGYHFVDHCIEILSHDKDYNKVKLYEHAVAHSGLPD

                     NARR"

     polyA_signal    1481..1602

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(1609..2064)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2091..2195

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        2197..2554

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2405..2540

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             2589..3383

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    3615..3662

                     /note="HSV TK poly(A) signal"

                     /note="herpes simplex virus thymidine kinase 

                     polyadenylation signal (Cole and Stacy, 1985)"

     rep_origin      3991..4579

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg

       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt

      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca

      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc

      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta

      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac

      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg

      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg

      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt

      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta

      601 ccggactcag atctcgagct caagcttcga attctgcagt cgacggtacc gcgggcccgg

      661 gatccaccgg tcgccaccat gagtgcgatt aagccagaca tgaagatcaa actccgtatg

      721 gaaggcaacg taaacgggca ccactttgtg atcgacggag atggtacagg caagcctttt

      781 gagggaaaac agagtatgga tcttgaagtc aaagagggcg gacctctgcc ttttgccttt

      841 gatatcctga ccactgcatt catgtacggc aacagggtat tcgccaaata tccagacaac

      901 atacaagact attttaagca gtcgtttcct aaggggtatt cgtgggaacg aagcttgact

      961 ttcgaagacg ggggcatttg cattgccaga aacgacataa caatggaagg ggacactttc

     1021 tataataaag ttcgatttta tggtaccaac tttcccgcca atggtccagt tatgcagaag

     1081 aagacgctga aatgggagcc ctccactgag aaaatgtatg tgcgtgatgg agtgctgacg

     1141 ggtgatattc atatggcttt gttgcttgaa ggaaatgccc attaccgatg tgacttcaga

     1201 actacttaca aagctaagga gaagggtgtc aagttaccag gctaccactt tgtggaccac

     1261 tgcattgaga ttttaagcca tgacaaagat tacaacaagg ttaagctgta tgagcatgct

     1321 gttgctcatt ctggattgcc tgacaatgcc agacgataag cggccgcgac tctagatcat

     1381 aatcagccat accacatttg tagaggtttt acttgcttta aaaaacctcc cacacctccc

     1441 cctgaacctg aaacataaaa tgaatgcaat tgttgttgtt aacttgttta ttgcagctta

     1501 taatggttac aaataaagca atagcatcac aaatttcaca aataaagcat ttttttcact

     1561 gcattctagt tgtggtttgt ccaaactcat caatgtatct taaggcgtaa attgtaagcg

     1621 ttaatatttt gttaaaattc gcgttaaatt tttgttaaat cagctcattt tttaaccaat

     1681 aggccgaaat cggcaaaatc ccttataaat caaaagaata gaccgagata gggttgagtg

     1741 ttgttccagt ttggaacaag agtccactat taaagaacgt ggactccaac gtcaaagggc

     1801 gaaaaaccgt ctatcagggc gatggcccac tacgtgaacc atcaccctaa tcaagttttt

     1861 tggggtcgag gtgccgtaaa gcactaaatc ggaaccctaa agggagcccc cgatttagag

     1921 cttgacgggg aaagccggcg aacgtggcga gaaaggaagg gaagaaagcg aaaggagcgg

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart