pCMV- Tag 4B Plasmid

$162.00

  • Model: PVT1029
  • 50 Units in Stock
Ask a question


Add to Cart:

pCMV-Tag 4B Plasmid

PVT1029 2ug

 

pCMV-Tag 4B Plasmid Information

Promoter: CMV

Replicon: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid Classification: Mammalian Cell Vector; Protein Overexpression Plasmid

Plasmid size: 4320 BP

Plasmid tag: C-FLAG tag

Prokaryotic resistance: kanamycin Kan

Screening marker: neomycin Neo

Cloning strain: XL1-Blue

Culture conditions: 37 C, aerobic, LB

Expression host: mammalian cells

Culture conditions: 37 C, aerobic, LB

Induction mode: instantaneous expression without induction

5'Sequencing Primers: CMV-F: CGCAAATGGGGGGGTAGGGGGGGTG

3'Sequencing Primers: Sequence-based Design

 

pCMV-Tag 4B Plasmid Sites

pCMV-Tag 4B-vector

 

pCMV-Tag 4B Plasmid Sequence

LOCUS       Exported                4320 bp ds-DNA     circular SYN 28-Nov-2013
DEFINITION  Mammalian expression vector for tagging proteins with a C-terminal
            FLAG epitope. For other reading frames, use pCMV-Tag 4A or pCMV-Tag
            4C.
ACCESSION   .
VERSION     .
KEYWORDS    pCMV-Tag 4B
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4320)
  AUTHORS   Agilent Technologies
  TITLE     Direct Submission
  JOURNAL   Exported 2016-9-18 from SnapGene Viewer 2.8.1
COMMENT     The cloned gene must include a Kozak sequence and start codon.
FEATURES             Location/Qualifiers
     source          1..4320
                     /organism="synthetic DNA construct"
                     /lab_host="Mammalian Cells"
                     /mol_type="other DNA"
     enhancer        66..370
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        371..574
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early
                     promoter"
     promoter        620..638
                     /note="T3 promoter"
                     /note="promoter for bacteriophage T3 RNA polymerase"
     misc_feature    651..744
                     /note="MCS"
                     /note="multiple cloning site"
     CDS             745..768
                     /codon_start=1
                     /product="FLAG epitope tag, followed by an enterokinase
                     cleavage site"
                     /note="FLAG"
                     /translation="DYKDDDDK"
     misc_feature    784..794
                     /note="stop codons"
                     /note="stop codons in all three reading frames"
     promoter        complement(822..840)
                     /note="T7 promoter"
                     /note="promoter for bacteriophage T7 RNA polymerase"
     polyA_signal    1114..1235
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1242..1697)
                     /direction=LEFT
                     /note="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        1724..1826
                     /gene="bla"
                     /note="AmpR promoter"
     promoter        1830..2187
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     CDS             2222..3016
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418
                     (Geneticin)"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     misc_feature    3248..3295
                     /note="HSV TK poly(A) signal"
                     /note="herpesvirus thymidine kinase polyadenylation signal"
     rep_origin      3624..4212
                     /direction=RIGHT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
ORIGIN
        1 atgcattagt tattaatagt aatcaattac ggggtcatta gttcatagcc catatatgga
       61 gttccgcgtt acataactta cggtaaatgg cccgcctggc tgaccgccca acgacccccg
      121 cccattgacg tcaataatga cgtatgttcc catagtaacg ccaataggga ctttccattg
      181 acgtcaatgg gtggagtatt tacggtaaac tgcccacttg gcagtacatc aagtgtatca
      241 tatgccaagt acgcccccta ttgacgtcaa tgacggtaaa tggcccgcct ggcattatgc
      301 ccagtacatg accttatggg actttcctac ttggcagtac atctacgtat tagtcatcgc
      361 tattaccatg gtgatgcggt tttggcagta catcaatggg cgtggatagc ggtttgactc
      421 acggggattt ccaagtctcc accccattga cgtcaatggg agtttgtttt ggcaccaaaa
      481 tcaacgggac tttccaaaat gtcgtaacaa ctccgcccca ttgacgcaaa tgggcggtag
      541 gcgtgtacgg tgggaggtct atataagcag agctggttta gtgaaccgtc agatccgcta
      601 gcgattacgc caagctcgaa attaaccctc actaaaggga acaaaagctg gagctccacc
      661 gcggtggcgg ccgctctagc ccgggcggat cccccgggct gcaggaattc gatatcaagc
      721 ttatcgatac cgtcgacact cgaggattac aaggatgacg acgataagta gggcccggta
      781 ccttaattaa ttaaggtacc aggtaagtgt acccaattcg ccctatagtg agtcgtatta
      841 caattcactc gatcgccctt cccaacagtt gcgcagcctg aatggcgaat ggagatccaa
      901 tttttaagtg tataatgtgt taaactactg attctaattg tttgtgtatt ttagattcac
      961 agtcccaagg ctcatttcag gcccctcagt cctcacagtc tgttcatgat cataatcagc
     1021 cataccacat ttgtagaggt tttacttgct ttaaaaaacc tcccacacct ccccctgaac
     1081 ctgaaacata aaatgaatgc aattgttgtt gttaacttgt ttattgcagc ttataatggt
     1141 tacaaataaa gcaatagcat cacaaatttc acaaataaag catttttttc actgcattct
     1201 agttgtggtt tgtccaaact catcaatgta tcttaacgcg taaattgtaa gcgttaatat
     1261 tttgttaaaa ttcgcgttaa atttttgtta aatcagctca ttttttaacc aataggccga
     1321 aatcggcaaa atcccttata aatcaaaaga atagaccgag atagggttga gtgttgttcc
     1381 agtttggaac aagagtccac tattaaagaa cgtggactcc aacgtcaaag ggcgaaaaac
     1441 cgtctatcag ggcgatggcc cactacgtga accatcaccc taatcaagtt ttttggggtc
     1501 gaggtgccgt aaagcactaa atcggaaccc taaagggagc ccccgattta gagcttgacg
     1561 gggaaagccg gcgaacgtgg cgagaaagga agggaagaaa gcgaaaggag cgggcgctag
     1621 ggcgctggca agtgtagcgg tcacgctgcg cgtaaccacc acacccgccg cgcttaatgc
     1681 gccgctacag ggcgcgtcag gtggcacttt tcggggaaat gtgcgcggaa cccctatttg
     1741 tttatttttc taaatacatt caaatatgta tccgctcatg agacaataac cctgataaat
     1801 gcttcaataa tattgaaaaa ggaagaatcc tgaggcggaa agaaccagct gtggaatgtg
     1861 tgtcagttag ggtgtggaaa gtccccaggc tccccagcag gcagaagtat gcaaagcatg
     1921 catctcaatt agtcagcaac caggtgtgga aagtccccag gctccccagc aggcagaagt
     1981 atgcaaagca tgcatctcaa ttagtcagca accatagtcc cgcccctaac tccgcccatc
     2041 ccgcccctaa ctccgcccag ttccgcccat tctccgcccc atggctgact aatttttttt
     2101 atttatgcag aggccgaggc cgcctcggcc tctgagctat tccagaagta gtgaggaggc
     2161 ttttttggag gcctaggctt ttgcaaagat cgatcaagag acaggatgag gatcgtttcg
     2221 catgattgaa caagatggat tgcacgcagg ttctccggcc gcttgggtgg agaggctatt
     2281 cggctatgac tgggcacaac agacaatcgg ctgctctgat gccgccgtgt tccggctgtc
     2341 agcgcagggg cgcccggttc tttttgtcaa gaccgacctg tccggtgccc tgaatgaact
     2401 gcaagacgag gcagcgcggc tatcgtggct ggccacgacg ggcgttcctt gcgcagctgt
     2461 gctcgacgtt gtcactgaag cgggaaggga ctggctgcta ttgggcgaag tgccggggca
     2521 ggatctcctg tcatctcacc ttgctcctgc cgagaaagta tccatcatgg ctgatgcaat
     2581 gcggcggctg catacgcttg atccggctac ctgcccattc gaccaccaag cgaaacatcg
     2641 catcgagcga gcacgtactc ggatggaagc cggtcttgtc gatcaggatg atctggacga
     2701 agaacatcag gggctcgcgc cagccgaact gttcgccagg ctcaaggcga gcatgcccga
     2761 cggcgaggat ctcgtcgtga cccatggcga tgcctgcttg ccgaatatca tggtggaaaa
     2821 tggccgcttt tctggattca tcgactgtgg ccggctgggt gtggcggacc gctatcagga
     2881 catagcgttg gctacccgtg atattgctga agaacttggc ggcgaatggg ctgaccgctt
     2941 cctcgtgctt tacggtatcg ccgctcccga ttcgcagcgc atcgccttct atcgccttct
     3001 tgacgagttc ttctgagcgg gactctgggg ttcgaaatga ccgaccaagc gacgcccaac
     3061 ctgccatcac gagatttcga ttccaccgcc gccttctatg aaaggttggg cttcggaatc
     3121 gttttccggg acgccggctg gatgatcctc cagcgcgggg atctcatgct ggagttcttc
     3181 gcccacccta gggggaggct aactgaaaca cggaaggaga caataccgga aggaacccgc
     3241 gctatgacgg caataaaaag acagaataaa acgcacggtg ttgggtcgtt tgttcataaa
     3301 cgcggggttc ggtcccaggg ctggcactct gtcgataccc caccgagacc ccattggggc
     3361 caatacgccc gcgtttcttc cttttcccca ccccaccccc caagttcggg tgaaggccca
     3421 gggctcgcag ccaacgtcgg ggcggcaggc cctgccatag cctcaggtta ctcatatata
     3481 ctttagattg atttaaaact tcatttttaa tttaaaagga tctaggtgaa gatccttttt
     3541 gataatctca tgaccaaaat cccttaacgt gagttttcgt tccactgagc gtcagacccc
     3601 gtagaaaaga tcaaaggatc ttcttgagat cctttttttc tgcgcgtaat ctgctgcttg
     3661 caaacaaaaa aaccaccgct accagcggtg gtttgtttgc cggatcaaga gctaccaact
     3721 ctttttccga aggtaactgg cttcagcaga gcgcagatac caaatactgt ccttctagtg
     3781 tagccgtagt taggccacca cttcaagaac tctgtagcac cgcctacata cctcgctctg
     3841 ctaatcctgt taccagtggc tgctgccagt ggcgataagt cgtgtcttac cgggttggac
     3901 tcaagacgat agttaccgga taaggcgcag cggtcgggct gaacgggggg ttcgtgcaca
     3961 cagcccagct tggagcgaac gacctacacc gaactgagat acctacagcg tgagctatga
     4021 gaaagcgcca cgcttcccga agggagaaag gcggacaggt atccggtaag cggcagggtc
     4081 ggaacaggag agcgcacgag ggagcttcca gggggaaacg cctggtatct ttatagtcct
     4141 gtcgggtttc gccacctctg acttgagcgt cgatttttgt gatgctcgtc aggggggcgg
     4201 agcctatgga aaaacgccag caacgcggcc tttttacggt tcctggcctt ttgctggcct
     4261 tttgctcaca tgttctttcc tgcgttatcc cctgattctg tggataaccg tattaccgcc
//

 

Search name

pCMV-Tag 4B,Plasmid pCMV-Tag 4B,pCMV-Tag 4B vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart