pCMV- VSV- G

$136.00

  • Model: PVT2330
  • 50 Units in Stock
Ask a question


Add to Cart:

pCMV-VSV-G

PVT2330      2ug

pCMV-VSV-G Description

pCMV-VSV-G expresses the G glycoprotein of the vesicular stomatitis virus (VSV-G) under the control of the CMV immediate-early promoter. VSV-G is used in pseudotyping of Moloney Murine Leukenia Virus (MMLV)-based retroviral vectors by mediating viral entry. VSV-G interacts with phospholipid components of the target cell membrane and fosters the fusion of viral and cellular membranes. VSV-G does not require a cell surface receptor and can serve as a surrogate viral envelope protein.

 

pCMV-VSV-G Information

Promoter: T7, CMV

Replicon: pUC ori, F1 ori

Terminator: beta -globin poly (A)

Plasmid classification: virus series, lentiviral packaging carrier

Prokaryotic resistance: Amp

Clone strain: Stbl3

Culture conditions: 37 C, aerobic LB

Expression host: lactation cells

Induction mode: no need to induce, transient expression.

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

Primers for 3'sequencing: primers designed based on sequences

 

pCMV-VSV-G Sequence

LOCUS       Exported                6507 bp ds-DNA    circular SYN 31-AUG-2017

KEYWORDS    pCMV-VSV-G

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 6507)

  TITLE     Direct Submission

  JOURNAL   Exported 2017-8-31

FEATURES             Location/Qualifiers

     source          1..6507

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      complement(206..794)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(965..1825)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(1826..1930)

                     /gene="bla"

                     /note="AmpR promoter"

     rep_origin      complement(1956..2411)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2579..2597

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     enhancer        2718..3097

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        3098..3301

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     intron          3413..3985

                     /note="beta-globin intron"

                     /note="intron from rabbit beta-globin gene"

     CDS             4071..5606

                     /codon_start=1

                     /gene="

                     "

                     /product="vesicular stomatitis virus G glycoprotein"

                     /note="VSV-G"

                     /note="Indiana strain"

                     /protein_id="

                     "

                     /translation="MKCLLYLAFLFIGVNCKFTIVFPHNQKGNWKNVPSNYHYCPSSSD

                     LNWHNDLIGTALQVKMPKSHKAIQADGWMCHASKWVTTCDFRWYGPKYITHSIRSFTPS

                     VEQCKESIEQTKQGTWLNPGFPPQSCGYATVTDAEAVIVQVTPHHVLVDEYTGEWVDSQ

                     FINGKCSNYICPTVHNSTTWHSDYKVKGLCDSNLISMDITFFSEDGELSSLGKEGTGFR

                     SNYFAYETGGKACKMQYCKHWGVRLPSGVWFEMADKDLFAAARFPECPEGSSISAPSQT

                     SVDVSLIQDVERILDYSLCQETWSKIRAGLPISPVDLSYLAPKNPGTGPAFTIINGTLK

                     YFETRYIRVDIAAPILSRMVGMISGTTTERELWDDWAPYEDVEIGPNGVLRTSSGYKFP

                     LYMIGHGMLDSDLHLSSKAQVFEHPHIQDAASQLPDDESLFFGDTGLSKNPIELVEGWF

                     SSWKSSIASFFFIIGLIIGLFLVLRVGIHLCIKLKHTKKRQIYTDIEMNRLGK"

     polyA_site      5898..5953

                     /note="beta-globin poly(A) signal"

                     /note="rabbit beta-globin polyadenylation signal"

ORIGIN

        1 gaggcggttt gcgtattggg cgctcttccg cttcctcgct cactgactcg ctgcgctcgg

       61 tcgttcggct gcggcgagcg gtatcagctc actcaaaggc ggtaatacgg ttatccacag

      121 aatcagggga taacgcagga aagaacatgt gagcaaaagg ccagcaaaag gccaggaacc

      181 gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg cccccctgac gagcatcaca

      241 aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg actataaaga taccaggcgt

      301 ttccccctgg aagctccctc gtgcgctctc ctgttccgac cctgccgctt accggatacc

      361 tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca tagctcacgc tgtaggtatc

      421 tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt gcacgaaccc cccgttcagc

      481 ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggta agacacgact

      541 tatcgccact ggcagcagcc actggtaaca ggattagcag agcgaggtat gtaggcggtg

      601 ctacagagtt cttgaagtgg tggcctaact acggctacac tagaagaaca gtatttggta

      661 tctgcgctct gctgaagcca gttaccttcg gaaaaagagt tggtagctct tgatccggca

      721 aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa gcagcagatt acgcgcagaa

      781 aaaaaggatc tcaagaagat cctttgatct tttctacggg gtctgacgct cagtggaacg

      841 aaaactcacg ttaagggatt ttggtcatga gattatcaaa aaggatcttc acctagatcc

      901 ttttaaatta aaaatgaagt tttaaatcaa tctaaagtat atatgagtaa acttggtctg

      961 acagttacca atgcttaatc agtgaggcac ctatctcagc gatctgtcta tttcgttcat

     1021 ccatagttgc ctgactcccc gtcgtgtaga taactacgat acgggagggc ttaccatctg

     1081 gccccagtgc tgcaatgata ccgcgagacc cacgctcacc ggctccagat ttatcagcaa

     1141 taaaccagcc agccggaagg gccgagcgca gaagtggtcc tgcaacttta tccgcctcca

     1201 tccagtctat taattgttgc cgggaagcta gagtaagtag ttcgccagtt aatagtttgc

     1261 gcaacgttgt tgccattgct acaggcatcg tggtgtcacg ctcgtcgttt ggtatggctt

     1321 cattcagctc cggttcccaa cgatcaaggc gagttacatg atcccccatg ttgtgcaaaa

     1381 aagcggttag ctccttcggt cctccgatcg ttgtcagaag taagttggcc gcagtgttat

     1441 cactcatggt tatggcagca ctgcataatt ctcttactgt catgccatcc gtaagatgct

     1501 tttctgtgac tggtgagtac tcaaccaagt cattctgaga atagtgtatg cggcgaccga

     1561 gttgctcttg cccggcgtca atacgggata ataccgcgcc acatagcaga actttaaaag

     1621 tgctcatcat tggaaaacgt tcttcggggc gaaaactctc aaggatctta ccgctgttga

     1681 gatccagttc gatgtaaccc actcgtgcac ccaactgatc ttcagcatct tttactttca

     1741 ccagcgtttc tgggtgagca aaaacaggaa ggcaaaatgc cgcaaaaaag ggaataaggg

     1801 cgacacggaa atgttgaata ctcatactct tcctttttca atattattga agcatttatc

     1861 agggttattg tctcatgagc ggatacatat ttgaatgtat ttagaaaaat aaacaaatag

     1921 gggttccgcg cacatttccc cgaaaagtgc cacctaaatt gtaagcgtta atattttgtt

     1981 aaaattcgcg ttaaattttt gttaaatcag ctcatttttt aaccaatagg ccgaaatcgg

     2041 caaaatccct tataaatcaa aagaatagac cgagataggg ttgagtgttg ttccagtttg

     2101 gaacaagagt ccactattaa agaacgtgga ctccaacgtc aaagggcgaa aaaccgtcta

     2161 tcagggcgat ggcccactac gtgaaccatc accctaatca agttttttgg ggtcgaggtg

     2221 ccgtaaagca ctaaatcgga accctaaagg gagcccccga tttagagctt gacggggaaa

     2281 gccggcgaac gtggcgagaa aggaagggaa gaaagcgaaa ggagcgggcg ctagggcgct

     2341 ggcaagtgta gcggtcacgc tgcgcgtaac caccacaccc gccgcgctta atgcgccgct

     2401 acagggcgcg tcccattcgc cattcaggct gcgcaactgt tgggaagggc gatcggtgcg

     2461 ggcctcttcg ctattacgcc agctggcgaa agggggatgt gctgcaaggc gattaagttg

     2521 ggtaacgcca gggttttccc agtcacgacg ttgtaaaacg acggccagtg agcgcgcgta

     2581 atacgactca ctatagggcg aattggagct ccaccgcggt ggcggccgct ctagagagct

     2641 tggcccattg catacgttgt atccatatca taatatgtac atttatattg gctcatgtcc

     2701 aacattaccg ccatgttgac attgattatt gactagttat taatagtaat caattacggg

     2761 gtcattagtt catagcccat atatggagtt ccgcgttaca taacttacgg taaatggccc

     2821 gcctggctga ccgcccaacg acccccgccc attgacgtca ataatgacgt atgttcccat

     2881 agtaacgcca atagggactt tccattgacg tcaatgggtg gagtatttac ggtaaactgc

     2941 ccacttggca gtacatcaag tgtatcatat gccaagtacg ccccctattg acgtcaatga

     3001 cggtaaatgg cccgcctggc attatgccca gtacatgacc ttatgggact ttcctacttg

     3061 gcagtacatc tacgtattag tcatcgctat taccatggtg atgcggtttt ggcagtacat

     3121 caatgggcgt ggatagcggt ttgactcacg gggatttcca agtctccacc ccattgacgt

     3181 caatgggagt ttgttttggc accaaaatca acgggacttt ccaaaatgtc gtaacaactc

     3241 cgccccattg acgcaaatgg gcggtaggcg tgtacggtgg gaggtctata taagcagagc

     3301 tcgtttagtg aaccgtcaga tcgcctggag acgccatcca cgctgttttg acctccatag

     3361 aagacaccgg gaccgatcca gcctccggtc gaccgatcct gagaacttca gggtgagttt

     3421 ggggaccctt gattgttctt tctttttcgc tattgtaaaa ttcatgttat atggaggggg

     3481 caaagttttc agggtgttgt ttagaatggg aagatgtccc ttgtatcacc atggaccctc

     3541 atgataattt tgtttctttc actttctact ctgttgacaa ccattgtctc ctcttatttt

     3601 cttttcattt tctgtaactt tttcgttaaa ctttagcttg catttgtaac gaatttttaa

     3661 attcactttt gtttatttgt cagattgtaa gtactttctc taatcacttt tttttcaagg

     3721 caatcagggt atattatatt gtacttcagc acagttttag agaacaattg ttataattaa

     3781 atgataaggt agaatatttc tgcatataaa ttctggctgg cgtggaaata ttcttattgg

     3841 tagaaacaac tacaccctgg tcatcatcct gcctttctct ttatggttac aatgatatac

     3901 actgtttgag atgaggataa aatactctga gtccaaaccg ggcccctctg ctaaccatgt

     3961 tcatgccttc ttctctttcc tacagctcct gggcaacgtg ctggttgttg tgctgtctca

     4021 tcattttggc aaagaattcc tcgacggatc cctcgaggaa ttctgacact atgaagtgcc

     4081 ttttgtactt agccttttta ttcattgggg tgaattgcaa gttcaccata gtttttccac

     4141 acaaccaaaa aggaaactgg aaaaatgttc cttctaatta ccattattgc ccgtcaagct

     4201 cagatttaaa ttggcataat gacttaatag gcacagcctt acaagtcaaa atgcccaaga

     4261 gtcacaaggc tattcaagca gacggttgga tgtgtcatgc ttccaaatgg gtcactactt

     4321 gtgatttccg ctggtatgga ccgaagtata taacacattc catccgatcc ttcactccat

     4381 ctgtagaaca atgcaaggaa agcattgaac aaacgaaaca aggaacttgg ctgaatccag

     4441 gcttccctcc tcaaagttgt ggatatgcaa ctgtgacgga tgccgaagca gtgattgtcc

     4501 aggtgactcc tcaccatgtg ctggttgatg aatacacagg agaatgggtt gattcacagt

     4561 tcatcaacgg aaaatgcagc aattacatat gccccactgt ccataactct acaacctggc

     4621 attctgacta taaggtcaaa gggctatgtg attctaacct catttccatg gacatcacct

     4681 tcttctcaga ggacggagag ctatcatccc tgggaaagga gggcacaggg ttcagaagta

     4741 actactttgc ttatgaaact ggaggcaagg cctgcaaaat gcaatactgc aagcattggg

     4801 gagtcagact cccatcaggt gtctggttcg agatggctga taaggatctc tttgctgcag

     4861 ccagattccc tgaatgccca gaagggtcaa gtatctctgc tccatctcag acctcagtgg

     4921 atgtaagtct aattcaggac gttgagagga tcttggatta ttccctctgc caagaaacct

     4981 ggagcaaaat cagagcgggt cttccaatct ctccagtgga tctcagctat cttgctccta

     5041 aaaacccagg aaccggtcct gctttcacca taatcaatgg taccctaaaa tactttgaga

     5101 ccagatacat cagagtcgat attgctgctc caatcctctc aagaatggtc ggaatgatca

     5161 gtggaactac cacagaaagg gaactgtggg atgactgggc accatatgaa gacgtggaaa

     5221 ttggacccaa tggagttctg aggaccagtt caggatataa gtttccttta tacatgattg

     5281 gacatggtat gttggactcc gatcttcatc ttagctcaaa ggctcaggtg ttcgaacatc

     5341 ctcacattca agacgctgct tcgcaacttc ctgatgatga gagtttattt tttggtgata

     5401 ctgggctatc caaaaatcca atcgagcttg tagaaggttg gttcagtagt tggaaaagct

     5461 ctattgcctc ttttttcttt atcatagggt taatcattgg actattcttg gttctccgag

     5521 ttggtatcca tctttgcatt aaattaaagc acaccaagaa aagacagatt tatacagaca

     5581 tagagatgaa ccgacttgga aagtaactca aatcctgcac aacagattct tcatgtttgg

     5641 accaaatcaa cttgtgatac catgctcaaa gaggcctcaa ttatatttga gtttttaatt

     5701 tttatgaaaa aaaaaaaaaa aaacggaatt cctcgaggga tccgtcgagg aattcactcc

     5761 tcaggtgcag gctgcctatc agaaggtggt ggctggtgtg gccaatgccc tggctcacaa

     5821 ataccactga gatctttttc cctctgccaa aaattatggg gacatcatga agccccttga

     5881 gcatctgact tctggctaat aaaggaaatt tattttcatt gcaatagtgt gttggaattt

     5941 tttgtgtctc tcactcggaa ggacatatgg gagggcaaat catttaaaac atcagaatga

     6001 gtatttggtt tagagtttgg caacatatgc ccatatgctg gctgccatga acaaaggttg

     6061 gctataaaga ggtcatcagt atatgaaaca gccccctgct gtccattcct tattccatag

     6121 aaaagccttg acttgaggtt agattttttt tatattttgt tttgtgttat ttttttcttt

     6181 aacatcccta aaattttcct tacatgtttt actagccaga tttttcctcc tctcctgact

     6241 actcccagtc atagctgtcc ctcttctctt atggagatcc ctcgacggat cggccgcaat

     6301 tcgtaatcat gtcatagctg tttcctgtgt gaaattgtta tccgctcaca attccacaca

     6361 acatacgagc cggaagcata aagtgtaaag cctggggtgc ctaatgagtg agctaactca

     6421 cattaattgc gttgcgctca ctgcccgctt tccagtcggg aaacctgtcg tgccagctgc

     6481 attaatgaat cggccaacgc gcgggga

//

Caution:
Product is for research use only!
 

Search name

pCMV-VSV-G,Plasmid pCMV-VSV-G,pCMV-VSV-G vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart