pCold- SUMO -10 ×His- 3C- Strep II- FLAG

$286.00

  • Model: PVTH0008
  • 50 Units in Stock
Ask a question


Add to Cart:

pCold-SUMO-10×His-3C-Strep II-FLAG

PVTH0008   2ug

 

pCold-SUMO-10×His-3C-Strep II-FLAG Information

Promoter: CspA promoter

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

Inducement: IPTG or lactose and its analogues

 

pCold-SUMO-10×His-3C-Strep II-FLAG Desription

PCold-SUMO-10 * His-3C-Strep II-FLAG plasmid is an Escherichia coli vector that can be expressed in low temperature.

pCold-SUMO-10-His-3C-Strep-II-FLAG-vector

pCold-SUMO-10×His-3C-Strep II-FLAG Sequence

LOCUS       Exported                4930 bp ds-DNA     circular SYN 12-OCT-2017

DEFINITION  synthetic circular DNA

KEYWORDS    pCold-SUMO-10×His-3C-Strep II-FLAG

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4930)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..4930

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    15..81

                     /label=cspA promoter

     protein_bind    84..100

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     CDS             271..343

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HMNWSHPQFEKSSGSSGGHHHHHH"

     CDS             365..653

                     /codon_start=1

                     /gene="S. cerevisiae SMT3 (truncated)"

                     /product="cleavable ubiquitin-like protein tag"

                     /label=SUMO

                     /translation="DSEVNQEAKPEVKPEVKPETHINLKVSDGSSEIFFKIKKTTPLRR

                     LMEAFAKRQGKEMDSLRFLYDGIRIQADQAPEDLDMEDNDIIEAHREQIG"

     CDS             676..705

                     /codon_start=1

                     /product="10xHis affinity tag"

                     /label=10xHis

                     /translation="HHHHHHHHHH"

     CDS             706..729

                     /codon_start=1

                     /product="recognition and cleavage site for human 

                     rhinovirus 3C and PreScission proteases"

                     /label=HRV 3C site

                     /translation="LEVLFQGP"

     CDS             775..798

                     /codon_start=1

                     /product="peptide that binds Strep-Tactin(R), an engineered

                     form of streptavidin"

                     /label=Strep-Tag II

                     /translation="WSHPQFEK"

     CDS             850..873

                     /codon_start=1

                     /product="FLAG(R) epitope tag, followed by an enterokinase 

                     cleavage site"

                     /label=FLAG

                     /translation="DYKDDDDK"

     rep_origin      complement(1234..1689)

                     /direction=LEFT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        1789..1893

                     /gene="bla"

                     /label=AmpR promoter

     CDS             1894..2754

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      2925..3513

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(3685..4767)

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /label=lacI

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     promoter        complement(4768..4845)

                     /gene="lacI"

                     /label=lacI promoter

ORIGIN

        1 aaggaatggt gtggccgatt aatcataaat atgaaaaata attgttgcat cacccgccaa

       61 tgcgtggctt aatgcacatc aaattgtgag cggataacaa tttgatgtgc tagcgcatat

      121 ccagtgtagt aaggcaagtc ccttcaagag ttatcgttga tacccctcgt agtgcacatt

      181 cctttaacgc ttcaaaatct gtaaagcacg ccatatcgcc gaaaggcaca cttaattatt

      241 aagaggtaat acaccatgaa tcacaaagtg catatgaatt ggagccaccc gcagttcgaa

      301 aaaagcagcg gcagcagcgg cggtcatcac catcatcatc acggcggcag cggcggcagc

      361 gggtcggact cagaagtcaa tcaagaagct aagccagagg tcaagccaga agtcaagcct

      421 gagactcaca tcaatttaaa ggtgtccgat ggatcttcag agatcttctt caagatcaaa

      481 aagaccactc ctttaagaag gctgatggaa gcgttcgcta aaagacaggg taaggaaatg

      541 gactccttaa gattcttgta cgacggtatt agaattcaag ctgatcaggc ccctgaagat

      601 ttggacatgg aggataacga tattattgag gctcaccgcg aacagattgg aggcctggag

      661 ctcggtaccc tcgagcatca ccatcaccat caccatcacc atcacctgga agttctgttc

      721 caggggcccg aattctatgg caggaagaag cggagacagc gacgaagagg atcctggagc

      781 cacccgcagt tcgagaaagc ggccgcatat ggcaggaaga agcggagaca gcgacgaaga

      841 taagtcgacg attacaagga tgacgacgat aagtaatcta gataggtaat ctctgcttaa

      901 aagcacagaa tctaagatcc ctgccattgg gcggggattt ttttatttgt tttcaggaaa

      961 taaataatcg atcgcgtaat aaaatctatt attatttttg tgaagaataa atttgggtgc

     1021 aatgagaatg cgcaggccct ttcgtctcgc gccgtttcgg tgatgacggt gaaaacctct

     1081 gacacatgca gctcccggag acggtcacag cttgtctgta agcggatgcc gggagcagac

     1141 aagcccgtca gggcgcgtca gcgggtgttg gcgggtgtcg gggctggctt aactatgcgg

     1201 catcagagca gattgtactg agagtgcacc ataaaattgt aaacgttaat attttgttaa

     1261 aattcgcgtt aaatttttgt taaatcagct cattttttaa ccaataggcc gaaatcggca

     1321 aaatccctta taaatcaaaa gaatagcccg agatagggtt gagtgttgtt ccagtttgga

     1381 acaagagtcc actattaaag aacgtggact ccaacgtcaa agggcgaaaa accgtctatc

     1441 agggcgatgg cccactacgt gaaccatcac ccaaatcaag ttttttgggg tcgaggtgcc

     1501 gtaaagcact aaatcggaac cctaaaggga gcccccgatt tagagcttga cggggaaagc

     1561 cggcgaacgt ggcgagaaag gaagggaaga aagcgaaagg agcgggcgct agggcgctgg

     1621 caagtgtagc ggtcacgctg cgcgtaacca ccacacccgc cgcgcttaat gcgccgctac

     1681 agggcgcgta ctatggttgc tttgacgtat gcggtgtgaa ataccgcaca gatgcgtaag

     1741 gagaaaatac cgcatcaggc gtcaggtggc acttttcggg gaaatgtgcg cggaacccct

     1801 atttgtttat ttttctaaat acattcaaat atgtatccgc tcatgagaca ataaccctga

     1861 taaatgcttc aataatattg aaaaaggaag agtatgagta ttcaacattt ccgtgtcgcc

     1921 cttattccct tttttgcggc attttgcctt cctgtttttg ctcacccaga aacgctggtg

     1981 aaagtaaaag atgctgaaga tcagttgggt gcacgagtgg gttacatcga actggatctc

     2041 aacagcggta agatccttga gagttttcgc cccgaagaac gttttccaat gatgagcact

     2101 tttaaagttc tgctatgtgg cgcggtatta tcccgtattg acgccgggca agagcaactc

     2161 ggtcgccgca tacactattc tcagaatgac ttggttgagt actcaccagt cacagaaaag

     2221 catcttacgg atggcatgac agtaagagaa ttatgcagtg ctgccataac catgagtgat

     2281 aacactgcgg ccaacttact tctgacaacg atcggaggac cgaaggagct aaccgctttt

     2341 ttgcacaaca tgggggatca tgtaactcgc cttgatcgtt gggaaccgga gctgaatgaa

     2401 gccataccaa acgacgagcg tgacaccacg atgcctgtag caatggcaac aacgttgcgc

     2461 aaactattaa ctggcgaact acttactcta gcttcccggc aacaattaat agactggatg

     2521 gaggcggata aagttgcagg accacttctg cgctcggccc ttccggctgg ctggtttatt

     2581 gctgataaat ctggagccgg tgagcgtggg tctcgcggta tcattgcagc actggggcca

     2641 gatggtaagc cctcccgtat cgtagttatc tacacgacgg ggagtcaggc aactatggat

     2701 gaacgaaata gacagatcgc tgagataggt gcctcactga ttaagcattg gtaactgtca

     2761 gaccaagttt actcatatat actttagatt gatttaaaac ttcattttta atttaaaagg

     2821 atctaggtga agatcctttt tgataatctc atgaccaaaa tcccttaacg tgagttttcg

     2881 ttccactgag cgtcagaccc cgtagaaaag atcaaaggat cttcttgaga tccttttttt

     2941 ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc taccagcggt ggtttgtttg

     3001 ccggatcaag agctaccaac tctttttccg aaggtaactg gcttcagcag agcgcagata

     3061 ccaaatactg ttcttctagt gtagccgtag ttaggccacc acttcaagaa ctctgtagca

     3121 ccgcctacat acctcgctct gctaatcctg ttaccagtgg ctgctgccag tggcgataag

     3181 tcgtgtctta ccgggttgga ctcaagacga tagttaccgg ataaggcgca gcggtcgggc

     3241 tgaacggggg gttcgtgcac acagcccagc ttggagcgaa cgacctacac cgaactgaga

     3301 tacctacagc gtgagctatg agaaagcgcc acgcttcccg aagggagaaa ggcggacagg

     3361 tatccggtaa gcggcagggt cggaacagga gagcgcacga gggagcttcc agggggaaac

     3421 gcctggtatc tttatagtcc tgtcgggttt cgccacctct gacttgagcg tcgatttttg

     3481 tgatgctcgt caggggggcg gagcctatgg aaaaacgcca gcaacgcggc ctttttacgg

     3541 ttcctggcct tttgctggcc ttttgctcac atagtcatgc cccgcgccca ccggaaggag

     3601 ctgactgggt tgaaggctct caagggcatc ggtcgagatc ccggtgccta atgagtgagc

     3661 taacttacat taattgcgtt gcgctcactg cccgctttcc agtcgggaaa cctgtcgtgc

     3721 cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg gtttgcgtat tgggcgccag

     3781 ggtggttttt cttttcacca gtgagacggg caacagctga ttgcccttca ccgcctggcc

     3841 ctgagagagt tgcagcaagc ggtccacgct ggtttgcccc agcaggcgaa aatcctgttt

     3901 gatggtggtt aacggcggga tataacatga gctgtcttcg gtatcgtcgt atcccactac

     3961 cgagatatcc gcaccaacgc gcagcccgga ctcggtaatg gcgcgcattg cgcccagcgc

     4021 catctgatcg ttggcaacca gcatcgcagt gggaacgatg ccctcattca gcatttgcat

     4081 ggtttgttga aaaccggaca tggcactcca gtcgccttcc cgttccgcta tcggctgaat

     4141 ttgattgcga gtgagatatt tatgccagcc agccagacgc agacgcgccg agacagaact

     4201 taatgggccc gctaacagcg cgatttgctg gtgacccaat gcgaccagat gctccacgcc

     4261 cagtcgcgta ccgtcttcat gggagaaaat aatactgttg atgggtgtct ggtcagagac

     4321 atcaagaaat aacgccggaa cattagtgca ggcagcttcc acagcaatgg catcctggtc

     4381 atccagcgga tagttaatga tcagcccact gacgcgttgc gcgagaagat tgtgcaccgc

     4441 cgctttacag gcttcgacgc cgcttcgttc taccatcgac accaccacgc tggcacccag

     4501 ttgatcggcg cgagatttaa tcgccgcgac aatttgcgac ggcgcgtgca gggccagact

     4561 ggaggtggca acgccaatca gcaacgactg tttgcccgcc agttgttgtg ccacgcggtt

     4621 gggaatgtaa ttcagctccg ccatcgccgc ttccactttt tcccgcgttt tcgcagaaac

     4681 gtggctggcc tggttcacca cgcgggaaac ggtctgataa gagacaccgg catactctgc

     4741 gacatcgtat aacgttactg gtttcacatt caccaccctg aattgactct cttccgggcg

     4801 ctatcatgcc ataccgcgaa aggttttgcg ccattcgatg gtgtccggga tctcgacgct

     4861 ctcccttatg cgactcctgc attaggaagc agcccagtag taggttgagg ccgttgagca

     4921 ccgccgccgc

//

Caution:
Product is for research use only!

 

pCold-SUMO-10×His-3C-Strep II-FLAG Alternative name

pCold-SUMO-10×His-3C-Strep II-FLAG, pCold-SUMO-10×His-3C-Strep II-FLAG Vector, pCold-SUMO-10×His-3C-Strep II-FLAG plasmid, pCold-SUMO-10×His-3C-Strep II-FLAG sequence, pCold-SUMO-10×His-3C-Strep II-FLAG map

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart