pCS2+

$216.00

  • Model: PVT5701
  • 50 Units in Stock
Ask a question


Add to Cart:

pCS2+

PVT5701 2ug

 

 

pCS2+ Information

Promoters: CMV IE94, LAC, T3, SP6

Replicator: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid classification: mammalian expression vector; wide host vector; in vitro expression vector.

Plasmid size: 4095bp

Prokaryotic resistance: ampicillin Ampicillin

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: prokaryotic cells, mammals, Xenopus, birds, zebrafish

Culture conditions: Reference Literature

5'sequencing primers: SP6 FWD (MCS1), T3 FWD (MCS2)

3'sequencing primers: EBV rev (MCS1), SV40 polyA rev (MCS2)

 

pCS2+ Description

PCS2+ vector can express high level in a variety of cells. PCS2+ vector can also transcribe and translate in vitro.

pCS2+

 

Publication for PVT5701 pCS2 Plasmid 
Developmental Cell
Volume 51, Issue 4, 18 November 2019, Pages 446-459.e5
Journal home page for Developmental Cell
Article:
MicroRNAs Establish the Right-Handed Dominance of the Heart Laterality Pathway in Vertebrates
Author links open overlay panelLucianoRago12NoemiCastroviejo1HassanFazilaty13FranciscoGarcia-Asencio1Oscar H.Oca?a1JoanGalcerán1M. AngelaNieto14
https://doi.org/10.1016/j.devcel.2019.09.012

 

pCS2+ Sequence

LOCUS       Exported                4095 bp ds-DNA     circular SYN 06-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    pCS2+

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4095)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Saturday, September 10, 2016 from SnapGene Viewer 3.1.4

FEATURES             Location/Qualifiers

     source          1..4095

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        35..53

                     /note="SP6 promoter"

                     /note="promoter for bacteriophage SP6 RNA polymerase"

     promoter        complement(122..139)

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     polyA_signal    144..278

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     promoter        complement(391..409)

                     /note="T3 promoter"

                     /note="promoter for bacteriophage T3 RNA polymerase"

     primer_bind     complement(430..446)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    454..470

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(478..508)

                     /note="lac promoter"

                     /note="promoter for the E. coli lac operon"

     protein_bind    523..544

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding site"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(832..1420)

                     /direction=LEFT

                     /note="pUC ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1591..2451)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2452..2556)

                     /gene="bla"

                     /note="AmpR promoter"

     rep_origin      complement(2582..3037)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        3111..4095

                     /note="CMV IE94 promoter"

                     /note="enhancer/promoter region of simian cytomegalovirus 

                     major immediate early transcription unit IE94"

ORIGIN

        1 cgccattctg cctggggacg tcggagcaag cttgatttag gtgacactat agaatacaag

       61 ctacttgttc tttttgcagg atcccatcga ttcgaattca aggcctctcg agcctctaga

      121 actatagtga gtcgtattac gtagatccag acatgataag atacattgat gagtttggac

      181 aaaccacaac tagaatgcag tgaaaaaaat gctttatttg tgaaatttgt gatgctattg

      241 ctttatttgt aaccattata agctgcaata aacaagttaa caacaacaat tgcattcatt

      301 ttatgtttca ggttcagggg gaggtgtggg aggtttttta attcgcggcc gcggcgccaa

      361 tgcattgggc ccggtaccca gcttttgttc cctttagtga gggttaattg cgcgcttggc

      421 gtaatcatgg tcatagctgt ttcctgtgtg aaattgttat ccgctcacaa ttccacacaa

      481 catacgagcc ggaagcataa agtgtaaagc ctggggtgcc taatgagtga gctaactcac

      541 attaattgcg ttgcgctcac tgcccgcttt ccagtcggga aacctgtcgt gccagctgca

      601 ttaatgaatc ggccaacgcg cggggagagg cggtttgcgt attgggcgct cttccgcttc

      661 ctcgctcact gactcgctgc gctcggtcgt tcggctgcgg cgagcggtat cagctcactc

      721 aaaggcggta atacggttat ccacagaatc aggggataac gcaggaaaga acatgtgagc

      781 aaaaggccag caaaaggcca ggaaccgtaa aaaggccgcg ttgctggcgt ttttccatag

      841 gctccgcccc cctgacgagc atcacaaaaa tcgacgctca agtcagaggt ggcgaaaccc

      901 gacaggacta taaagatacc aggcgtttcc ccctggaagc tccctcgtgc gctctcctgt

      961 tccgaccctg ccgcttaccg gatacctgtc cgcctttctc ccttcgggaa gcgtggcgct

     1021 ttctcatagc tcacgctgta ggtatctcag ttcggtgtag gtcgttcgct ccaagctggg

     1081 ctgtgtgcac gaaccccccg ttcagcccga ccgctgcgcc ttatccggta actatcgtct

     1141 tgagtccaac ccggtaagac acgacttatc gccactggca gcagccactg gtaacaggat

     1201 tagcagagcg aggtatgtag gcggtgctac agagttcttg aagtggtggc ctaactacgg

     1261 ctacactaga aggacagtat ttggtatctg cgctctgctg aagccagtta ccttcggaaa

     1321 aagagttggt agctcttgat ccggcaaaca aaccaccgct ggtagcggtg gtttttttgt

     1381 ttgcaagcag cagattacgc gcagaaaaaa aggatctcaa gaagatcctt tgatcttttc

     1441 tacggggtct gacgctcagt ggaacgaaaa ctcacgttaa gggattttgg tcatgagatt

     1501 atcaaaaagg atcttcacct agatcctttt aaattaaaaa tgaagtttta aatcaatcta

     1561 aagtatatat gagtaaactt ggtctgacag ttaccaatgc ttaatcagtg aggcacctat

     1621 ctcagcgatc tgtctatttc gttcatccat agttgcctga ctccccgtcg tgtagataac

     1681 tacgatacgg gagggcttac catctggccc cagtgctgca atgataccgc gagacccacg

     1741 ctcaccggct ccagatttat cagcaataaa ccagccagcc ggaagggccg agcgcagaag

     1801 tggtcctgca actttatccg cctccatcca gtctattaat tgttgccggg aagctagagt

     1861 aagtagttcg ccagttaata gtttgcgcaa cgttgttgcc attgctacag gcatcgtggt

     1921 gtcacgctcg tcgtttggta tggcttcatt cagctccggt tcccaacgat caaggcgagt

     1981 tacatgatcc cccatgttgt gcaaaaaagc ggttagctcc ttcggtcctc cgatcgttgt

     2041 cagaagtaag ttggccgcag tgttatcact catggttatg gcagcactgc ataattctct

     2101 tactgtcatg ccatccgtaa gatgcttttc tgtgactggt gagtactcaa ccaagtcatt

     2161 ctgagaatag tgtatgcggc gaccgagttg ctcttgcccg gcgtcaatac gggataatac

     2221 cgcgccacat agcagaactt taaaagtgct catcattgga aaacgttctt cggggcgaaa

     2281 actctcaagg atcttaccgc tgttgagatc cagttcgatg taacccactc gtgcacccaa

     2341 ctgatcttca gcatctttta ctttcaccag cgtttctggg tgagcaaaaa caggaaggca

     2401 aaatgccgca aaaaagggaa taagggcgac acggaaatgt tgaatactca tactcttcct

     2461 ttttcaatat tattgaagca tttatcaggg ttattgtctc atgagcggat acatatttga

     2521 atgtatttag aaaaataaac aaataggggt tccgcgcaca tttccccgaa aagtgccacc

     2581 taaattgtaa gcgttaatat tttgttaaaa ttcgcgttaa atttttgtta aatcagctca

     2641 ttttttaacc aataggccga aatcggcaaa atcccttata aatcaaaaga atagaccgag

     2701 atagggttga gtgttgttcc agtttggaac aagagtccac tattaaagaa cgtggactcc

     2761 aacgtcaaag ggcgaaaaac cgtctatcag ggcgatggcc cactacgtga accatcaccc

     2821 taatcaagtt ttttggggtc gaggtgccgt aaagcactaa atcggaaccc taaagggagc

     2881 ccccgattta gagcttgacg gggaaagccg gcgaacgtgg cgagaaagga agggaagaaa

     2941 gcgaaaggag cgggcgctag ggcgctggca agtgtagcgg tcacgctgcg cgtaaccacc

     3001 acacccgccg cgcttaatgc gccgctacag ggcgcgtccc attcgccatt caggctgcgc

     3061 aactgttggg aagggcgatc ggtgcgggcc tcttcgctat tacgccagtc gaccatagcc

     3121 aattcaatat ggcgtatatg gactcatgcc aattcaatat ggtggatctg gacctgtgcc

     3181 aattcaatat ggcgtatatg gactcgtgcc aattcaatat ggtggatctg gaccccagcc

     3241 aattcaatat ggcggacttg gcaccatgcc aattcaatat ggcggacttg gcactgtgcc

     3301 aactggggag gggtctactt ggcacggtgc caagtttgag gaggggtctt ggccctgtgc

     3361 caagtccgcc atattgaatt ggcatggtgc caataatggc ggccatattg gctatatgcc

     3421 aggatcaata tataggcaat atccaatatg gccctatgcc aatatggcta ttggccaggt

     3481 tcaatactat gtattggccc tatgccatat agtattccat atatgggttt tcctattgac

     3541 gtagatagcc cctcccaatg ggcggtccca tataccatat atggggcttc ctaataccgc

     3601 ccatagccac tcccccattg acgtcaatgg tctctatata tggtctttcc tattgacgtc

     3661 atatgggcgg tcctattgac gtatatggcg cctcccccat tgacgtcaat tacggtaaat

     3721 ggcccgcctg gctcaatgcc cattgacgtc aataggacca cccaccattg acgtcaatgg

     3781 gatggctcat tgcccattca tatccgttct cacgccccct attgacgtca atgacggtaa

     3841 atggcccact tggcagtaca tcaatatcta ttaatagtaa cttggcaagt acattactat

     3901 tggaaggacg ccagggtaca ttggcagtac tcccattgac gtcaatggcg gtaaatggcc

     3961 cgcgatggct gccaagtaca tccccattga cgtcaatggg gaggggcaat gacgcaaatg

     4021 ggcgttccat tgacgtaaat gggcggtagg cgtgcctaat gggaggtcta tataagcaat

     4081 gctcgtttag ggaac

//

 


Caution:
Product is for research use only!

 

Search name

pCS2+,Plasmid pCS2+,pCS2+ vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart