pCXSN- HA

$193.00

  • Model: PVT11177
  • 50 Units in Stock
Ask a question


Add to Cart:

pCXSN-HA

Catalog No. PVT11177
Packing 2ug

 

pCXSN-HA Information

Function plant expression plasmid

Promoter: CaMV 35S promoter

Terminator: NOS Terminator

Plasmid size: 10832bp

Plasmid label: N-HA

Prokaryotic resistance: kanamycin Kan

Screening markers: hygromycin Hyg

Cloned strain: Escherichia coli DB3.1

Culture conditions: 37 centigrade, aerobic, LB

 

pCXSN-HA Description

PCXSN-HA  is a plant overexpressed plasmid, and 35S promoter drives HA and target gene fusion expression. Under the action of CCDB lethal gene, the clone gene becomes more easy and the positive rate is high.

 

pCXSN-HA Sequence

LOCUS       Exported               10832 bp ds-DNA     circular SYN 30-OCT-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 10832)

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..10832

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      7..270

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             627..932

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     CDS             complement(988..1014)

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     promoter        complement(1032..1922)

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     misc_feature    2156..2180

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             3479..4108

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             4542..5609

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      5675..5869

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    6213..6353

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(6539..7127)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(7214..8008)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    8433..8457

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    8535..8709

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(8749..9774)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(9841..10518)

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

ORIGIN

        1 gaattccgat ctagtaacat agatgacacc gcgcgcgata atttatccta gtttgcgcgc

       61 tatattttgt tttctatcgc gtattaaatg tataattgcg ggactctaat cataaaaacc

      121 catctcataa ataacgtcat gcattacatg ttaattatta catgcttaac gtaattcaac

      181 agaaattata tgataatcat cgcaagaccg gcaacaggat tcaatcttaa gaaactttat

      241 tgccaaatgt ttgaacgatc ggggaaattc gctagtggat ccccaatact tgtatggggc

      301 ttactaaaag ccagataaca gtatgcgtat ttgcgcgctg atttttgcgg tataagaata

      361 tatactgata tgtatacccg aagtatgtca aaaagaggta tgctatgaag cagcgtatta

      421 cagtgacagt tgacagcgac agctatcagt tgctcaaggc atatatgatg tcaatatctc

      481 cggtctggta agcacaacca tgcagaatga agcccgtcgt ctgcgtgccg aacgctggaa

      541 agcggaaaat caggaaggga tggctgaggt cgcccggttt attgaaatga acggctcttt

      601 tgctgacgag aacaggggct ggtgaaatgc agtttaaggt ttacacctat aaaagagaga

      661 gccgttatcg tctgtttgtg gatgtacaga gtgatattat tgacacgccc gggcgacgga

      721 tggtgatccc cctggccagt gcacgtctgc tgtcagataa agtctcccgt gaactttacc

      781 cggtggtgca tatcggggat gaaagctggc gcatgatgac caccgatatg gccagtgtgc

      841 cggtctccgt tatcggggaa gaagtggctg atctcagcca ccgcgaaaat gacatcaaaa

      901 acgccattaa cctgatgttc tggggaatat aaatgtcagg ctcccttata cacagccagt

      961 ctgcaggtcg acccatacaa gtattggagc gtaatctgga acatcgtatg ggtacatgga

     1021 tccccctcga gtatcgttcg taaatggtga aaattttcag aaaattgctt ttgctttaaa

     1081 agaaatgatt taaattgctg caatagaagt agaatgcttg attgcttgag attcgtttgt

     1141 tttgtatatg ttgtgttgag gtcgaggtcc tctccaaatg aaatgaactt ccttatatag

     1201 aggaagggtc ttgcgaagga tagtgggatt gtgcgtcatc ccttacgtca gtggagatat

     1261 cacatcaatc cacttgcttt gaagacgtgg ttggaacgtc ttctttttcc acgatgctcc

     1321 tcgtgggtgg gggtccatct ttgggaccac tgtcggcaga ggcatcttca acgatggcct

     1381 ttcctttatc gcaatgatgg catttgtagg agccaccttc cttttccact atcttcacaa

     1441 taaagtgaca gatagctggg caatggaatc cgaggaggtt tccggatatt accctttgtt

     1501 gaaaagtctc aattgccctt tggtcttctg agactgtatc tttgatattt ttggagtaga

     1561 caagtgtgtc gtgctccacc atgttatcac atcaatccac ttgctttgaa gacgtggttg

     1621 gaacgtcttc tttttccacg atgctcctcg tgggtggggg tccatctttg ggaccactgt

     1681 cggcagaggc atcttcaacg atggcctttc ctttatcgca atgatggcat ttgtaggagc

     1741 caccttcctt ttccactatc ttcacaataa agtgacagat agctgggcaa tggaatccga

     1801 ggaggtttcc ggatattacc ctttgttgaa aagtctcaat tgccctttgg tcttctgaga

     1861 ctgtatcttt gatatttttg gagtagacaa gtgtgtcgtg ctccaccatg ttgacctgca

     1921 ggcatgcaag cttggcactg gccgtcgttt tacaacgtcg tgactgggaa aaccctggcg

     1981 ttacccaact taatcgcctt gcagcacatc cccctttcgc cagctggcgt aatagcgaag

     2041 aggcccgcac cgatcgccct tcccaacagt tgcgcagcct gaatggcgaa tgctagagca

     2101 gcttgagctt ggatcagatt gtcgtttccc gccttcagtt taaactatca gtgtttgaca

     2161 ggatatattg gcgggtaaac ctaagagaaa agagcgttta ttagaataac ggatatttaa

     2221 aagggcgtga aaaggtttat ccgttcgtcc atttgtatgt gcatgccaac cacagggttc

     2281 ccctcgggat caaagtactt tgatccaacc cctccgctgc tatagtgcag tcggcttctg

     2341 acgttcagtg cagccgtctt ctgaaaacga catgtcgcac aagtcctaag ttacgcgaca

     2401 ggctgccgcc ctgccctttt cctggcgttt tcttgtcgcg tgttttagtc gcataaagta

     2461 gaatacttgc gactagaacc ggagacatta cgccatgaac aagagcgccg ccgctggcct

     2521 gctgggctat gcccgcgtca gcaccgacga ccaggacttg accaaccaac gggccgaact

     2581 gcacgcggcc ggctgcacca agctgttttc cgagaagatc accggcacca ggcgcgaccg

     2641 cccggagctg gccaggatgc ttgaccacct agccctggcg acgttgtgac agtgaccagg

     2701 ctagaccgcc tggcccgcag cacccgcgac ctactggaca ttgccgagcg catccaggag

     2761 gccggcgcgg gcctgcgtag cctggcagag ccgtgggccg acaccaccac gccggccggc

     2821 cgcatggtgt tgaccgtgtt cgccggcatt gccgagttcg agcgttccct aatcatcgac

     2881 cgcacccgga gcgggcgcga ggccgccaag gcccgaggcg tgaagtttgg cccccgccct

     2941 accctcaccc cggcacagat cgcgcacgcc cgcgagctga tcgaccagga aggccgcacc

     3001 gtgaaagagg cggctgcact gcttggcgtg catcgctcga ccctgtaccg cgcacttgag

     3061 cgcagcgagg aagtgacgcc caccgaggcc aggcggcgcg gtgccttccg tgaggacgca

     3121 ttgaccgagg ccgacgccct ggcggccgcc gagaatgaac gccaagagga acaagcatga

     3181 aaccgcacca ggacggccag gacgaaccgt ttttcattac cgaagagatc gaggcggaga

     3241 tgatcgcggc cgggtacgtg ttcgagccgc ccgcgcacgt ctcaaccgtg cggctgcatg

     3301 aaatcctggc cggtttgtct gatgccaagc tggcggcctg gccggccagc ttggccgctg

     3361 aagaaaccga gcgccgccgt ctaaaaaggt gatgtgtatt tgagtaaaac agcttgcgtc

     3421 atgcggtcgc tgcgtatatg atgcgatgag taaataaaca aatacgcaag gggaacgcat

     3481 gaaggttatc gctgtactta accagaaagg cgggtcaggc aagacgacca tcgcaaccca

     3541 tctagcccgc gccctgcaac tcgccggggc cgatgttctg ttagtcgatt ccgatcccca

     3601 gggcagtgcc cgcgattggg cggccgtgcg ggaagatcaa ccgctaaccg ttgtcggcat

     3661 cgaccgcccg acgattgacc gcgacgtgaa ggccatcggc cggcgcgact tcgtagtgat

     3721 cgacggagcg ccccaggcgg cggacttggc tgtgtccgcg atcaaggcag ccgacttcgt

     3781 gctgattccg gtgcagccaa gcccttacga catatgggcc accgccgacc tggtggagct

     3841 ggttaagcag cgcattgagg tcacggatgg aaggctacaa gcggcctttg tcgtgtcgcg

     3901 ggcgatcaaa ggcacgcgca tcggcggtga ggttgccgag gcgctggccg ggtacgagct

     3961 gcccattctt gagtcccgta tcacgcagcg cgtgagctac ccaggcactg ccgccgccgg

     4021 cacaaccgtt cttgaatcag aacccgaggg cgacgctgcc cgcgaggtcc aggcgctggc

     4081 cgctgaaatt aaatcaaaac tcatttgagt taatgaggta aagagaaaat gagcaaaagc

     4141 acaaacacgc taagtgccgg ccgtccgagc gcacgcagca gcaaggctgc aacgttggcc

     4201 agcctggcag acacgccagc catgaagcgg gtcaactttc agttgccggc ggaggatcac

     4261 accaagctga agatgtacgc ggtacgccaa ggcaagacca ttaccgagct gctatctgaa

     4321 tacatcgcgc agctaccaga gtaaatgagc aaatgaataa atgagtagat gaattttagc

     4381 ggctaaagga ggcggcatgg aaaatcaaga acaaccaggc accgacgccg tggaatgccc

     4441 catgtgtgga ggaacgggcg gttggccagg cgtaagcggc tgggttgtct gccggccctg

     4501 caatggcact ggaaccccca agcccgagga atcggcgtga cggtcgcaaa ccatccggcc

     4561 cggtacaaat cggcgcggcg ctgggtgatg acctggtgga gaagttgaag gccgcgcagg

     4621 ccgcccagcg gcaacgcatc gaggcagaag cacgccccgg tgaatcgtgg caagcggccg

     4681 ctgatcgaat ccgcaaagaa tcccggcaac cgccggcagc cggtgcgccg tcgattagga

     4741 agccgcccaa gggcgacgag caaccagatt ttttcgttcc gatgctctat gacgtgggca

     4801 cccgcgatag tcgcagcatc atggacgtgg ccgttttccg tctgtcgaag cgtgaccgac

     4861 gagctggcga ggtgatccgc tacgagcttc cagacgggca cgtagaggtt tccgcagggc

     4921 cggccggcat ggccagtgtg tgggattacg acctggtact gatggcggtt tcccatctaa

     4981 ccgaatccat gaaccgatac cgggaaggga agggagacaa gcccggccgc gtgttccgtc

     5041 cacacgttgc ggacgtactc aagttctgcc ggcgagccga tggcggaaag cagaaagacg

     5101 acctggtaga aacctgcatt cggttaaaca ccacgcacgt tgccatgcag cgtacgaaga

     5161 aggccaagaa cggccgcctg gtgacggtat ccgagggtga agccttgatt agccgctaca

     5221 agatcgtaaa gagcgaaacc gggcggccgg agtacatcga gatcgagcta gctgattgga

     5281 tgtaccgcga gatcacagaa ggcaagaacc cggacgtgct gacggttcac cccgattact

     5341 ttttgatcga tcccggcatc ggccgttttc tctaccgcct ggcacgccgc gccgcaggca

     5401 aggcagaagc cagatggttg ttcaagacga tctacgaacg cagtggcagc gccggagagt

     5461 tcaagaagtt ctgtttcacc gtgcgcaagc tgatcgggtc aaatgacctg ccggagtacg

     5521 atttgaagga ggaggcgggg caggctggcc cgatcctagt catgcgctac cgcaacctga

     5581 tcgagggcga agcatccgcc ggttcctaat gtacggagca gatgctaggg caaattgccc

     5641 tagcagggga aaaaggtcga aaaggtctct ttcctgtgga tagcacgtac attgggaacc

     5701 caaagccgta cattgggaac cggaacccgt acattgggaa cccaaagccg tacattggga

     5761 accggtcaca catgtaagtg actgatataa aagagaaaaa aggcgatttt tccgcctaaa

     5821 actctttaaa acttattaaa actcttaaaa cccgcctggc ctgtgcataa ctgtctggcc

     5881 agcgcacagc cgaagagctg caaaaagcgc ctacccttcg gtcgctgcgc tccctacgcc

     5941 ccgccgcttc gcgtcggcct atcgcggccg ctggccgctc aaaaatggct ggcctacggc

     6001 caggcaatct accagggcgc ggacaagccg cgccgtcgcc actcgaccgc cggcgcccac

     6061 atcaaggcac cctgcctcgc gcgtttcggt gatgacggtg aaaacctctg acacatgcag

     6121 ctcccggaga cggtcacagc ttgtctgtaa gcggatgccg ggagcagaca agcccgtcag

     6181 ggcgcgtcag cgggtgttgg cgggtgtcgg ggcgcagcca tgacccagtc acgtagcgat

     6241 agcggagtgt atactggctt aactatgcgg catcagagca gattgtactg agagtgcacc

     6301 atatgcggtg tgaaataccg cacagatgcg taaggagaaa ataccgcatc aggcgctctt

     6361 ccgcttcctc gctcactgac tcgctgcgct cggtcgttcg gctgcggcga gcggtatcag

     6421 ctcactcaaa ggcggtaata cggttatcca cagaatcagg ggataacgca ggaaagaaca

     6481 tgtgagcaaa aggccagcaa aaggccagga accgtaaaaa ggccgcgttg ctggcgtttt

     6541 tccataggct ccgcccccct gacgagcatc acaaaaatcg acgctcaagt cagaggtggc

     6601 gaaacccgac aggactataa agataccagg cgtttccccc tggaagctcc ctcgtgcgct

     6661 ctcctgttcc gaccctgccg cttaccggat acctgtccgc ctttctccct tcgggaagcg

     6721 tggcgctttc tcatagctca cgctgtaggt atctcagttc ggtgtaggtc gttcgctcca

     6781 agctgggctg tgtgcacgaa ccccccgttc agcccgaccg ctgcgcctta tccggtaact

     6841 atcgtcttga gtccaacccg gtaagacacg acttatcgcc actggcagca gccactggta

     6901 acaggattag cagagcgagg tatgtaggcg gtgctacaga gttcttgaag tggtggccta

     6961 actacggcta cactagaagg acagtatttg gtatctgcgc tctgctgaag ccagttacct

     7021 tcggaaaaag agttggtagc tcttgatccg gcaaacaaac caccgctggt agcggtggtt

     7081 tttttgtttg caagcagcag attacgcgca gaaaaaaagg atctcaagaa gatcctttga

     7141 tcttttctac ggggtctgac gctcagtgga acgaaaactc acgttaaggg attttggtca

     7201 tgcattctag gtactaaaac aattcatcca gtaaaatata atattttatt ttctcccaat

     7261 caggcttgat ccccagtaag tcaaaaaata gctcgacata ctgttcttcc ccgatatcct

     7321 ccctgatcga ccggacgcag aaggcaatgt cataccactt gtccgccctg ccgcttctcc

     7381 caagatcaat aaagccactt actttgccat ctttcacaaa gatgttgctg tctcccaggt

     7441 cgccgtggga aaagacaagt tcctcttcgg gcttttccgt ctttaaaaaa tcatacagct

     7501 cgcgcggatc tttaaatgga gtgtcttctt cccagttttc gcaatccaca tcggccagat

     7561 cgttattcag taagtaatcc aattcggcta agcggctgtc taagctattc gtatagggac

     7621 aatccgatat gtcgatggag tgaaagagcc tgatgcactc cgcatacagc tcgataatct

     7681 tttcagggct ttgttcatct tcatactctt ccgagcaaag gacgccatcg gcctcactca

     7741 tgagcagatt gctccagcca tcatgccgtt caaagtgcag gacctttgga acaggcagct

     7801 ttccttccag ccatagcatc atgtcctttt cccgttccac atcataggtg gtccctttat

     7861 accggctgtc cgtcattttt aaatataggt tttcattttc tcccaccagc ttatatacct

     7921 tagcaggaga cattccttcc gtatctttta cgcagcggta tttttcgatc agttttttca

     7981 attccggtga tattctcatt ttagccattt attatttcct tcctcttttc tacagtattt

     8041 aaagataccc caagaagcta attataacaa gacgaactcc aattcactgt tccttgcatt

     8101 ctaaaacctt aaataccaga aaacagcttt ttcaaagttg ttttcaaagt tggcgtataa

     8161 catagtatcg acggagccga ttttgaaacc gcggtgatca caggcagcaa cgctctgtca

     8221 tcgttacaat caacatgcta ccctccgcga gatcatccgt gtttcaaacc cggcagctta

     8281 gttgccgttc ttccgaatag catcggtaac atgagcaaag tctgccgcct tacaacggct

     8341 ctcccgctga cgccgtcccg gactgatggg ctgcctgtat cgagtggtga ttttgtgccg

     8401 agctgccggt cggggagctg ttggctggct ggtggcagga tatattgtgg tgtaaacaaa

     8461 ttgacgctta gacaacttaa taacacattg cggacgtttt taatgtactg aattaacgcc

     8521 gaattaattc gggggatctg gattttagta ctggattttg gttttaggaa ttagaaattt

     8581 tattgataga agtattttac aaatacaaat acatactaag ggtttcttat atgctcaaca

     8641 catgagcgaa accctatagg aaccctaatt cccttatctg ggaactactc acacattatt

     8701 atggagaaac tcgagcttgt cgatcgacag atccggtcgg catctactct atttctttgc

     8761 cctcggacga gtgctggggc gtcggtttcc actatcggcg agtacttcta cacagccatc

     8821 ggtccagacg gccgcgcttc tgcgggcgat ttgtgtacgc ccgacagtcc cggctccgga

     8881 tcggacgatt gcgtcgcatc gaccctgcgc ccaagctgca tcatcgaaat tgccgtcaac

     8941 caagctctga tagagttggt caagaccaat gcggagcata tacgcccgga gtcgtggcga

     9001 tcctgcaagc tccggatgcc tccgctcgaa gtagcgcgtc tgctgctcca tacaagccaa

     9061 ccacggcctc cagaagaaga tgttggcgac ctcgtattgg gaatccccga acatcgcctc

     9121 gctccagtca atgaccgctg ttatgcggcc attgtccgtc aggacattgt tggagccgaa

     9181 atccgcgtgc acgaggtgcc ggacttcggg gcagtcctcg gcccaaagca tcagctcatc

     9241 gagagcctgc gcgacggacg cactgacggt gtcgtccatc acagtttgcc agtgatacac

     9301 atggggatca gcaatcgcgc atatgaaatc acgccatgta gtgtattgac cgattccttg

     9361 cggtccgaat gggccgaacc cgctcgtctg gctaagatcg gccgcagcga tcgcatccat

     9421 agcctccgcg accggttgta gaacagcggg cagttcggtt tcaggcaggt cttgcaacgt

     9481 gacaccctgt gcacggcggg agatgcaata ggtcaggctc tcgctaaact ccccaatgtc

     9541 aagcacttcc ggaatcggga gcgcggccga tgcaaagtgc cgataaacat aacgatcttt

     9601 gtagaaacca tcggcgcagc tatttacccg caggacatat ccacgccctc ctacatcgaa

     9661 gctgaaagca cgagattctt cgccctccga gagctgcatc aggtcggaga cgctgtcgaa

     9721 cttttcgatc agaaacttct cgacagacgt cgcggtgagt tcaggctttt tcatatctca

     9781 ttgccccccg gatctgcgaa agctcgagag agatagattt gtagagagag actggtgatt

     9841 tcagcgtgtc ctctccaaat gaaatgaact tccttatata gaggaaggtc ttgcgaagga

     9901 tagtgggatt gtgcgtcatc ccttacgtca gtggagatat cacatcaatc cacttgcttt

     9961 gaagacgtgg ttggaacgtc ttctttttcc acgatgctcc tcgtgggtgg gggtccatct

    10021 ttgggaccac tgtcggcaga ggcatcttga acgatagcct ttcctttatc gcaatgatgg

    10081 catttgtagg tgccaccttc cttttctact gtccttttga tgaagtgaca gatagctggg

    10141 caatggaatc cgaggaggtt tcccgatatt accctttgtt gaaaagtctc aatagccctt

    10201 tggtcttctg agactgtatc tttgatattc ttggagtaga cgagagtgtc gtgctccacc

    10261 atgttatcac atcaatccac ttgctttgaa gacgtggttg gaacgtcttc tttttccacg

    10321 atgctcctcg tgggtggggg tccatctttg ggaccactgt cggcagaggc atcttgaacg

    10381 atagcctttc ctttatcgca atgatggcat ttgtaggtgc caccttcctt ttctactgtc

    10441 cttttgatga agtgacagat agctgggcaa tggaatccga ggaggtttcc cgatattacc

    10501 ctttgttgaa aagtctcaat agccctttgg tcttctgaga ctgtatcttt gatattcttg

    10561 gagtagacga gagtgtcgtg ctccaccatg ttggcaagct gctctagcca atacgcaaac

    10621 cgcctctccc cgcgcgttgg ccgattcatt aatgcagctg gcacgacagg tttcccgact

    10681 ggaaagcggg cagtgagcgc aacgcaatta atgtgagtta gctcactcat taggcacccc

    10741 aggctttaca ctttatgctt ccggctcgta tgttgtgtgg aattgtgagc ggataacaat

    10801 ttcacacagg aaacagctat gaccatgatt ac

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart