pCXUN- HA

$193.00

  • Model: PVT11173
  • 50 Units in Stock
Ask a question


Add to Cart:

pCXUN-HA

Catalog No. PVT11173
Packing 2ug

 

pCXUN-HA Informaiton
Function plant expression plasmid

Prokaryotic resistance: kanamycin Kan

Screening markers: hygromycin Hyg

Cloned strain: Escherichia coli DB3.1

Culture conditions: 37 degrees centigrade

 

pCXUN-HA Description

PCXUN-HA is a plant pCX series protein expression plasmid.

 

pCXUN-HA Sequence

LOCUS       Exported               12038 bp ds-DNA     circular SYN 04-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..12038

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      115..367

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             728..1033

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     CDS             complement(1089..1115)

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     promoter        complement(1131..3121)

                     /label=Ubi promoter

                     /note="maize polyubiquitin gene promoter"

     misc_feature    3362..3386

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             4685..5314

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             5748..6815

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      6881..7075

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    7419..7559

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(7745..8333)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(8420..9214)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    9639..9663

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    9741..9915

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(9955..10980)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(11047..11724)

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

ORIGIN

        1 gaattcgagc tcggtacccc tggcgaaagg gggatgtgct gcaaggcgat taagttgggt

       61 aacgccaggg ttttcccagt cacgacgttg taaaacgacg gccagtgaat tcccgatcta

      121 gtaacataga tgacaccgcg cgcgataatt tatcctagtt tgcgcgctat attttgtttt

      181 ctatcgcgta ttaaatgtat aattgcggga ctctaatcat aaaaacccat ctcataaata

      241 acgtcatgca ttacatgtta attattacat gcttaacgta attcaacaga aattatatga

      301 taatcatcgc aagaccggca acaggattca atcttaagaa actttattgc caaatgtttg

      361 aacgatcggg gaaattcgga tccccaatac ttgtatgggg cttactaaaa gccagataac

      421 agtatgcgta tttgcgcgct gatttttgcg gtataagaat atatactgat atgtataccc

      481 gaagtatgtc aaaaagaggt atgctatgaa gcagcgtatt acagtgacag ttgacagcga

      541 cagctatcag ttgctcaagg catatatgat gtcaatatct ccggtctggt aagcacaacc

      601 atgcagaatg aagcccgtcg tctgcgtgcc gaacgctgga aagcggaaaa tcaggaaggg

      661 atggctgagg tcgcccggtt tattgaaatg aacggctctt ttgctgacga gaacaggggc

      721 tggtgaaatg cagtttaagg tttacaccta taaaagagag agccgttatc gtctgtttgt

      781 ggatgtacag agtgatatta ttgacacgcc cgggcgacgg atggtgatcc ccctggccag

      841 tgcacgtctg ctgtcagata aagtctcccg tgaactttac ccggtggtgc atatcgggga

      901 tgaaagctgg cgcatgatga ccaccgatat ggccagtgtg ccggtctccg ttatcgggga

      961 agaagtggct gatctcagcc accgcgaaaa tgacatcaaa aacgccatta acctgatgtt

     1021 ctggggaata taaatgtcag gctcccttat acacagccag tctgcaggtc gacccataca

     1081 agtattggag cgtaatctgg aacatcgtat gggtacatgg atcccccggg ctgcagaagt

     1141 aacaccaaac aacagggtga gcatcgacaa aagaaacagt accaagcaaa taaatagcgt

     1201 atgaaggcag ggctaaaaaa atccacatat agctgctgca tatgccatca tccaagtata

     1261 tcaagatcaa aataattata aaacatactt gtttattata atagataggt actcaaggtt

     1321 agagcatatg aatagatgct gcatatgcca tcatgtatat gcatcagtaa aacccacatc

     1381 aacatgtata cctatcctag atcgatattt ccatccatct taaactcgta actatgaaga

     1441 tgtatgacac acacatacag ttccaaaatt aataaataca ccaggtagtt tgaaacagta

     1501 ttctactccg atctagaacg aatgaacgac cgcccaacca caccacatca tcacaaccaa

     1561 gcgaacaaaa agcatctctg tatatgcatc agtaaaaccc gcatcaacat gtatacctat

     1621 cctagatcga tatttccatc catcatcttc aattcgtaac tatgaatatg tatggcacac

     1681 acatacagat ccaaaattaa taaatccacc aggtagtttg aaacagaatt ctactccgat

     1741 ctagaacgac cgcccaacca gaccacatca tcacaaccaa gacaaaaaaa agcatgaaaa

     1801 gatgacccga caaacaagtg cacggcatat attgaaataa aggaaaaggg caaaccaaac

     1861 cctatgcaac gaaacaaaaa aaatcatgaa atcgatcccg tctgcggaac ggctagagcc

     1921 atcccaggat tccccaaaga gaaacactgg caagttagca atcagaacgt gtctgacgta

     1981 caggtcgcat ccgtgtacga acgctagcag cacggatcta acacaaacac ggatctaaca

     2041 caaacatgaa cagaagtaga actaccgggc cctaaccatg gaccggaacg ccgatctaga

     2101 gaaggtagag aggggggggg ggggaggacg agcggcgtac cttgaagcgg aggtgccgac

     2161 gggtggattt gggggagatc tggttgtgtg tgtgtgcgct ccgaacaaca cgaggttggg

     2221 gaaagagggt gtggaggggg tgtctattta ttacggcggg cgaggaaggg aaagcgaagg

     2281 agcggtggga aaggaatccc ccgtagctgc cgtgccgtga gaggaggagg aggccgcctg

     2341 ccgtgccggc tcacgtctgc cgctccgcca cgcatttctg gatgccgaca gcggagcaag

     2401 tccaacggtg gagcggaact ctcgagaggg gtccagaggc agcgacagag atgccgtgcc

     2461 gtctgcttcg cttggcccga cgcgacgctg ctggttcgct ggttggtgtc cgttagactc

     2521 gtcgacggcg tttaacaggc tggcattatc tactcgaaac aagaaaaatg tttccttagt

     2581 ttttttaatt tcttaaaggg tatttgttta atttttagtc actttatttt attctatttt

     2641 atatctaaat tattaaataa aaaaactaaa atagagtttt agttttctta atttagaggc

     2701 taaaatagaa taaaatagat gtactaaaaa aattagtcta taaaaaccat taaccctaaa

     2761 ccctaaatgg atgtactaat aaaatggatg aagtattata taggtgaagc tatttgcaaa

     2821 aaaaaaggag aacacatgca cactaaaaag ataaaactgt agagtcctgt tgtcaaaata

     2881 ctcaattgtc ctttagacca tgtctaactg ttcatttata tgattctcta aaacactgat

     2941 attattgtag tactatagat tatattattc gtagagtaaa gtttaaatat atgtataaag

     3001 atagataaac tgcacttcaa acaagtgtga caaaaaaaat atgtggtaat tttttataac

     3061 ttagacatgc aatgctcatt atctctagag aggggcacga ccgggtcacg ctgcactgca

     3121 ggaattcgat atcaagcttg gcactggccg tcgttttaca acgtcgtgac tgggaaaacc

     3181 ctggcgttac ccaacttaat cgccttgcag cacatccccc tttcgccag

//

*Caution

Product is for research use only!
 

Search Name

pCXUN-HA, pCXUN-HA vector, pCXUN-HA plasmid, pCXUN-HA map, pCXUN-HA sequence

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart