pCXUN

$193.00

  • Model: PVT11172
  • 50 Units in Stock
Ask a question


Add to Cart:

pCXUN

Catalog No. PVT11172
Packing 2ug

Function plant expression plasmid
Resistance Kan
Screen Hyg
Strain DB3.1
Culture temperature 37degrees centigrade

 

pCXUN Information

Promoter: Ubi promoter

Terminator: NOS Terminator

Plasmid size: 12008bp

Prokaryotic resistance: kanamycin Kan

Screening markers: hygromycin Hyg

Cloned strain: Escherichia coli DB3.1

Culture conditions: 37 centigrade, aerobic, LB

 

pCXUN Description

PCXUN  is a plant overexpression vector, and Ubi promoter drives the expression of target genes. The T carrier was obtained by using the XcmI enzyme cut carrier, which could be attached to the PCR products with A at both ends. The positive rate of the gene clone was greatly improved with the help of the CCDB lethal gene.

 

pCXUN Sequence

LOCUS       Exported               12008 bp ds-DNA     circular SYN 30-OCT-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 12008)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..12008

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      115..367

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(439..744)

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     promoter        complement(1101..3091)

                     /label=Ubi promoter

                     /note="maize polyubiquitin gene promoter"

     misc_feature    3332..3356

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             4655..5284

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             5718..6785

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      6851..7045

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    7389..7529

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(7715..8303)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(8390..9184)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     misc_feature    9609..9633

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     polyA_signal    9711..9885

                     /label=CaMV poly(A) signal

                     /note="cauliflower mosaic virus polyadenylation signal"

     CDS             complement(9925..10950)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     K"

     promoter        complement(11017..11694)

                     /label=CaMV 35S promoter (enhanced)

                     /note="cauliflower mosaic virus 35S promoter with a 

                     duplicated enhancer region"

ORIGIN

        1 gaattcgagc tcggtacccc tggcgaaagg gggatgtgct gcaaggcgat taagttgggt

       61 aacgccaggg ttttcccagt cacgacgttg taaaacgacg gccagtgaat tcccgatcta

      121 gtaacataga tgacaccgcg cgcgataatt tatcctagtt tgcgcgctat attttgtttt

      181 ctatcgcgta ttaaatgtat aattgcggga ctctaatcat aaaaacccat ctcataaata

      241 acgtcatgca ttacatgtta attattacat gcttaacgta attcaacaga aattatatga

      301 taatcatcgc aagaccggca acaggattca atcttaagaa actttattgc caaatgtttg

      361 aacgatcggg gaaattcgga tccccaatac ttgtatgggt cgacctgcag actggctgtg

      421 tataagggag cctgacattt atattcccca gaacatcagg ttaatggcgt ttttgatgtc

      481 attttcgcgg tggctgagat cagccacttc ttccccgata acggagaccg gcacactggc

      541 catatcggtg gtcatcatgc gccagctttc atccccgata tgcaccaccg ggtaaagttc

      601 acgggagact ttatctgaca gcagacgtgc actggccagg gggatcacca tccgtcgccc

      661 gggcgtgtca ataatatcac tctgtacatc cacaaacaga cgataacggc tctctctttt

      721 ataggtgtaa accttaaact gcatttcacc agcccctgtt ctcgtcagca aaagagccgt

      781 tcatttcaat aaaccgggcg acctcagcca tcccttcctg attttccgct ttccagcgtt

      841 cggcacgcag acgacgggct tcattctgca tggttgtgct taccagaccg gagatattga

      901 catcatatat gccttgagca actgatagct gtcgctgtca actgtcactg taatacgctg

      961 cttcatagca tacctctttt tgacatactt cgggtataca tatcagtata tattcttata

     1021 ccgcaaaaat cagcgcgcaa atacgcatac tgttatctgg cttttagtaa gccccataca

     1081 agtattgggg atcccccggg ctgcagaagt aacaccaaac aacagggtga gcatcgacaa

     1141 aagaaacagt accaagcaaa taaatagcgt atgaaggcag ggctaaaaaa atccacatat

     1201 agctgctgca tatgccatca tccaagtata tcaagatcaa aataattata aaacatactt

     1261 gtttattata atagataggt actcaaggtt agagcatatg aatagatgct gcatatgcca

     1321 tcatgtatat gcatcagtaa aacccacatc aacatgtata cctatcctag atcgatattt

     1381 ccatccatct taaactcgta actatgaaga tgtatgacac acacatacag ttccaaaatt

     1441 aataaataca ccaggtagtt tgaaacagta ttctactccg atctagaacg aatgaacgac

     1501 cgcccaacca caccacatca tcacaaccaa gcgaacaaaa agcatctctg tatatgcatc

     1561 agtaaaaccc gcatcaacat gtatacctat cctagatcga tatttccatc catcatcttc

     1621 aattcgtaac tatgaatatg tatggcacac acatacagat ccaaaattaa taaatccacc

     1681 aggtagtttg aaacagaatt ctactccgat ctagaacgac cgcccaacca gaccacatca

     1741 tcacaaccaa gacaaaaaaa agcatgaaaa gatgacccga caaacaagtg cacggcatat

     1801 attgaaataa aggaaaaggg caaaccaaac cctatgcaac gaaacaaaaa aaatcatgaa

     1861 atcgatcccg tctgcggaac ggctagagcc atcccaggat tccccaaaga gaaacactgg

     1921 caagttagca atcagaacgt gtctgacgta caggtcgcat ccgtgtacga acgctagcag

     1981 cacggatcta acacaaacac ggatctaaca caaacatgaa cagaagtaga actaccgggc

     2041 cctaaccatg gaccggaacg ccgatctaga gaaggtagag aggggggggg ggggaggacg

     2101 agcggcgtac cttgaagcgg aggtgccgac gggtggattt gggggagatc tggttgtgtg

     2161 tgtgtgcgct ccgaacaaca cgaggttggg gaaagagggt gtggaggggg tgtctattta

     2221 ttacggcggg cgaggaaggg aaagcgaagg agcggtggga aaggaatccc ccgtagctgc

     2281 cgtgccgtga gaggaggagg aggccgcctg ccgtgccggc tcacgtctgc cgctccgcca

     2341 cgcatttctg gatgccgaca gcggagcaag tccaacggtg gagcggaact ctcgagaggg

     2401 gtccagaggc agcgacagag atgccgtgcc gtctgcttcg cttggcccga cgcgacgctg

     2461 ctggttcgct ggttggtgtc cgttagactc gtcgacggcg tttaacaggc tggcattatc

     2521 tactcgaaac aagaaaaatg tttccttagt ttttttaatt tcttaaaggg tatttgttta

     2581 atttttagtc actttatttt attctatttt atatctaaat tattaaataa aaaaactaaa

     2641 atagagtttt agttttctta atttagaggc taaaatagaa taaaatagat gtactaaaaa

     2701 aattagtcta taaaaaccat taaccctaaa ccctaaatgg atgtactaat aaaatggatg

     2761 aagtattata taggtgaagc tatttgcaaa aaaaaaggag aacacatgca cactaaaaag

     2821 ataaaactgt agagtcctgt tgtcaaaata ctcaattgtc ctttagacca tgtctaactg

     2881 ttcatttata tgattctcta aaacactgat attattgtag tactatagat tatattattc

     2941 gtagagtaaa gtttaaatat atgtataaag atagataaac tgcacttcaa acaagtgtga

     3001 caaaaaaaat atgtggtaat tttttataac ttagacatgc aatgctcatt atctctagag

     3061 aggggcacga ccgggtcacg ctgcactgca ggaattcgat atcaagcttg gcactggccg

     3121 tcgttttaca acgtcgtgac tgggaaaacc ctggcgttac ccaacttaat cgccttgcag

     3181 cacatccccc tttcgccagc tggcgtaata gcgaagaggc ccgcaccgat cgcccttccc

     3241 aacagttgcg cagcctgaat ggcgaatgct agagcagctt gagcttggat cagattgtcg

     3301 tttcccgcct tcagtttaaa ctatcagtgt ttgacaggat atattggcgg gtaaacctaa

     3361 gagaaaagag cgtttattag aataacggat atttaaaagg gcgtgaaaag gtttatccgt

     3421 tcgtccattt gtatgtgcat gccaaccaca gggttcccct cgggatcaaa gtactttgat

     3481 ccaacccctc cgctgctata gtgcagtcgg cttctgacgt tcagtgcagc cgtcttctga

     3541 aaacgacatg tcgcacaagt cctaagttac gcgacaggct gccgccctgc ccttttcctg

     3601 gcgttttctt gtcgcgtgtt ttagtcgcat aaagtagaat acttgcgact agaaccggag

     3661 acattacgcc atgaacaaga gcgccgccgc tggcctgctg ggctatgccc gcgtcagcac

     3721 cgacgaccag gacttgacca accaacgggc cgaactgcac gcggccggct gcaccaagct

     3781 gttttccgag aagatcaccg gcaccaggcg cgaccgcccg gagctggcca ggatgcttga

     3841 ccacctagcc ctggcgacgt tgtgacagtg accaggctag accgcctggc ccgcagcacc

     3901 cgcgacctac tggacattgc cgagcgcatc caggaggccg gcgcgggcct gcgtagcctg

     3961 gcagagccgt gggccgacac caccacgccg gccggccgca tggtgttgac cgtgttcgcc

     4021 ggcattgccg agttcgagcg ttccctaatc atcgaccgca cccggagcgg gcgcgaggcc

     4081 gccaaggccc gaggcgtgaa gtttggcccc cgccctaccc tcaccccggc acagatcgcg

     4141 cacgcccgcg agctgatcga ccaggaaggc cgcaccgtga aagaggcggc tgcactgctt

     4201 ggcgtgcatc gctcgaccct gtaccgcgca cttgagcgca gcgaggaagt gacgcccacc

     4261 gaggccaggc ggcgcggtgc cttccgtgag gacgcattga ccgaggccga cgccctggcg

     4321 gccgccgaga atgaacgcca agaggaacaa gcatgaaacc gcaccaggac ggccaggacg

     4381 aaccgttttt cattaccgaa gagatcgagg cggagatgat cgcggccggg tacgtgttcg

     4441 agccgcccgc gcacgtctca accgtgcggc tgcatgaaat cctggccggt ttgtctgatg

     4501 ccaagctggc ggcctggccg gccagcttgg ccgctgaaga aaccgagcgc cgccgtctaa

     4561 aaaggtgatg tgtatttgag taaaacagct tgcgtcatgc ggtcgctgcg tatatgatgc

     4621 gatgagtaaa taaacaaata cgcaagggga acgcatgaag gttatcgctg tacttaacca

     4681 gaaaggcggg tcaggcaaga cgaccatcgc aacccatcta gcccgcgccc tgcaactcgc

     4741 cggggccgat gttctgttag tcgattccga tccccagggc agtgcccgcg attgggcggc

     4801 cgtgcgggaa gatcaaccgc taaccgttgt cggcatcgac cgcccgacga ttgaccgcga

     4861 cgtgaaggcc atcggccggc gcgacttcgt agtgatcgac ggagcgcccc aggcggcgga

     4921 cttggctgtg tccgcgatca aggcagccga cttcgtgctg attccggtgc agccaagccc

     4981 ttacgacata tgggcaaccg ccgacctggt ggagctggtt aagcagcgca ttgaggtcac

     5041 ggatggaagg ctacaagcgg cctttgtcgt gtcgcgggcg atcaaaggca cgcgcatcgg

     5101 cggtgaggtt gccgaggcgc tggccgggta cgagctgccc attcttgagt cccgtatcac

     5161 gcagcgcgtg agctacccag gcactgccgc cgccggcaca accgttcttg aatcagaacc

     5221 cgagggcgac gctgcccgcg aggtccaggc gctggccgct gaaattaaat caaaactcat

     5281 ttgagttaat gaggtaaaga gaaaatgagc aaaagcacaa acacgctaag tgccggccgt

     5341 ccgagcgcac gcagcagcaa ggctgcaacg ttggccagcc tggcagacac gccagccatg

     5401 aagcgggtca actttcagtt gccggcggag gatcacacca agctgaagat gtacgcggta

     5461 cgccaaggca agaccattac cgagctgcta tctgaataca tcgcgcagct accagagtaa

     5521 atgagcaaat gaataaatga gtagatgaat tttagcggct aaaggaggcg gcatggaaaa

     5581 tcaagaacaa ccaggcaccg acgccgtgga atgccccatg tgtggaggaa cgggcggttg

     5641 gccaggcgta agcggctggg ttgtctgccg gccctgcaat ggcactggaa cccccaagcc

     5701 cgaggaatcg gcgtgacggt cgcaaaccat ccggcccggt acaaatcggc gcggcgctgg

     5761 gtgatgacct ggtggagaag ttgaaggccg cgcaggccgc ccagcggcaa cgcatcgagg

     5821 cagaagcacg ccccggtgaa tcgtggcaag cggccgctga tcgaatccgc aaagaatccc

     5881 ggcaaccgcc ggcagccggt gcgccgtcga ttaggaagcc gcccaagggc gacgagcaac

     5941 cagatttttt cgttccgatg ctctatgacg tgggcacccg cgatagtcgc agcatcatgg

     6001 acgtggccgt tttccgtctg tcgaagcgtg accgacgagc tggcgaggtg atccgctacg

     6061 agcttccaga cgggcacgta gaggtttccg cagggccggc cggcatggcc agtgtgtggg

     6121 attacgacct ggtactgatg gcggtttccc atctaaccga atccatgaac cgataccggg

     6181 aagggaaggg agacaagccc ggccgcgtgt tccgtccaca cgttgcggac gtactcaagt

     6241 tctgccggcg agccgatggc ggaaagcaga aagacgacct ggtagaaacc tgcattcggt

     6301 taaacaccac gcacgttgcc atgcagcgta cgaagaaggc caagaacggc cgcctggtga

     6361 cggtatccga gggtgaagcc ttgattagcc gctacaagat cgtaaagagc gaaaccgggc

     6421 ggccggagta catcgagatc gagctagctg attggatgta ccgcgagatc acagaaggca

     6481 agaacccgga cgtgctgacg gttcaccccg attacttttt gatcgatccc ggcatcggcc

     6541 gttttctcta ccgcctggca cgccgcgccg caggcaaggc agaagccaga tggttgttca

     6601 agacgatcta cgaacgcagt ggcagcgccg gagagttcaa gaagttctgt ttcaccgtgc

     6661 gcaagctgat cgggtcaaat gacctgccgg agtacgattt gaaggaggag gcggggcagg

     6721 ctggcccgat cctagtcatg cgctaccgca acctgatcga gggcgaagca tccgccggtt

     6781 cctaatgtac ggagcagatg ctagggcaaa ttgccctagc aggggaaaaa ggtcgaaaag

     6841 gtctctttcc tgtggatagc acgtacattg ggaacccaaa gccgtacatt gggaaccgga

     6901 acccgtacat tgggaaccca aagccgtaca ttgggaaccg gtcacacatg taagtgactg

     6961 atataaaaga gaaaaaaggc gatttttccg cctaaaactc tttaaaactt attaaaactc

     7021 ttaaaacccg cctggcctgt gcataactgt ctggccagcg cacagccgaa gagctgcaaa

     7081 aagcgcctac ccttcggtcg ctgcgctccc tacgccccgc cgcttcgcgt cggcctatcg

     7141 cggccgctgg ccgctcaaaa atggctggcc tacggccagg caatctacca gggcgcggac

     7201 aagccgcgcc gtcgccactc gaccgccggc gcccacatca aggcaccctg cctcgcgcgt

     7261 ttcggtgatg acggtgaaaa cctctgacac atgcagctcc cggagacggt cacagcttgt

     7321 ctgtaagcgg atgccgggag cagacaagcc cgtcagggcg cgtcagcggg tgttggcggg

     7381 tgtcggggcg cagccatgac ccagtcacgt agcgatagcg gagtgtatac tggcttaact

     7441 atgcggcatc agagcagatt gtactgagag tgcaccatat gcggtgtgaa ataccgcaca

     7501 gatgcgtaag gagaaaatac cgcatcaggc gctcttccgc ttcctcgctc actgactcgc

     7561 tgcgctcggt cgttcggctg cggcgagcgg tatcagctca ctcaaaggcg gtaatacggt

     7621 tatccacaga atcaggggat aacgcaggaa agaacatgtg agcaaaaggc cagcaaaagg

     7681 ccaggaaccg taaaaaggcc gcgttgctgg cgtttttcca taggctccgc ccccctgacg

     7741 agcatcacaa aaatcgacgc tcaagtcaga ggtggcgaaa cccgacagga ctataaagat

     7801 accaggcgtt tccccctgga agctccctcg tgcgctctcc tgttccgacc ctgccgctta

     7861 ccggatacct gtccgccttt ctcccttcgg gaagcgtggc gctttctcat agctcacgct

     7921 gtaggtatct cagttcggtg taggtcgttc gctccaagct gggctgtgtg cacgaacccc

     7981 ccgttcagcc cgaccgctgc gccttatccg gtaactatcg tcttgagtcc aacccggtaa

     8041 gacacgactt atcgccactg gcagcagcca ctggtaacag gattagcaga gcgaggtatg

     8101 taggcggtgc tacagagttc ttgaagtggt ggcctaacta cggctacact agaaggacag

     8161 tatttggtat ctgcgctctg ctgaagccag ttaccttcgg aaaaagagtt ggtagctctt

     8221 gatccggcaa acaaaccacc gctggtagcg gtggtttttt tgtttgcaag cagcagatta

     8281 cgcgcagaaa aaaaggatct caagaagatc ctttgatctt ttctacgggg tctgacgctc

     8341 agtggaacga aaactcacgt taagggattt tggtcatgca ttctaggtac taaaacaatt

     8401 catccagtaa aatataatat tttattttct cccaatcagg cttgatcccc agtaagtcaa

     8461 aaaatagctc gacatactgt tcttccccga tatcctccct gatcgaccgg acgcagaagg

     8521 caatgtcata ccacttgtcc gccctgccgc ttctcccaag atcaataaag ccacttactt

     8581 tgccatcttt cacaaagatg ttgctgtctc ccaggtcgcc gtgggaaaag acaagttcct

     8641 cttcgggctt ttccgtcttt aaaaaatcat acagctcgcg cggatcttta aatggagtgt

     8701 cttcttccca gttttcgcaa tccacatcgg ccagatcgtt attcagtaag taatccaatt

     8761 cggctaagcg gctgtctaag ctattcgtat agggacaatc cgatatgtcg atggagtgaa

     8821 agagcctgat gcactccgca tacagctcga taatcttttc agggctttgt tcatcttcat

     8881 actcttccga gcaaaggacg ccatcggcct cactcatgag cagattgctc cagccatcat

     8941 gccgttcaaa gtgcaggacc tttggaacag gcagctttcc ttccagccat agcatcatgt

     9001 ccttttcccg ttcaacatca taggtggtcc ctttataccg gctgtccgtc atttttaaat

     9061 ataggttttc attttctccc accagcttat ataccttagc aggagacatt ccttccgtat

     9121 cttttacgca gcggtatttt tcgatcagtt ttttcaattc cggtgatatt ctcattttag

     9181 ccatttatta tttccttcct cttttctaca gtatttaaag ataccccaag aagctaatta

     9241 taacaagacg aactccaatt cactgttcct tgcattctaa aaccttaaat accagaaaac

     9301 agctttttca aagttgtttt caaagttggc gtataacata gtatcgacgg agccgatttt

     9361 gaaaccgcgg tgatcacagg cagcaacgct ctgtcatcgt tacaatcaac atgctaccct

     9421 ccgcgagatc atccgtgttt caaacccggc agcttagttg ccgttcttcc gaatagcatc

     9481 ggtaacatga gcaaagtctg ccgccttaca acggctctcc cgctgacgcc gtcccggact

     9541 gatgggctgc ctgtatcgag tggtgatttt gtgccgagct gccggtcggg gagctgttgg

     9601 ctggctggtg gcaggatata ttgtggtgta aacaaattga cgcttagaca acttaataac

     9661 acattgcgga cgtttttaat gtactgaatt aacgccgaat taattcgggg gatctggatt

     9721 ttagtactgg attttggttt taggaattag aaattttatt gatagaagta ttttacaaat

     9781 acaaatacat actaagggtt tcttatatgc tcaacacatg agcgaaaccc tataggaacc

     9841 ctaattccct tatctgggaa ctactcacac attattatgg agaaactcga gcttgtcgat

     9901 cgacagatcc ggtcggcatc tactctattt ctttgccctc ggacgagtgc tggggcgtcg

     9961 gtttccacta tcggcgagta cttctacaca gccatcggtc cagacggccg cgcttctgcg

    10021 ggcgatttgt gtacgcccga cagtcccggc tccggatcgg acgattgcgt cgcatcgacc

    10081 ctgcgcccaa gctgcatcat cgaaattgcc gtcaaccaag ctctgataga gttggtcaag

    10141 accaatgcgg agcatatacg cccggagtcg tggcgatcct gcaagctccg gatgcctccg

    10201 ctcgaagtag cgcgtctgct gctccataca agccaaccac ggcctccaga agaagatgtt

    10261 ggcgacctcg tattgggaat ccccgaacat cgcctcgctc cagtcaatga ccgctgttat

    10321 gcggccattg tccgtcagga cattgttgga gccgaaatcc gcgtgcacga ggtgccggac

    10381 ttcggggcag tcctcggccc aaagcatcag ctcatcgaga gcctgcgcga cggacgcact

    10441 gacggtgtcg tccatcacag tttgccagtg atacacatgg ggatcagcaa tcgcgcatat

    10501 gaaatcacgc catgtagtgt attgaccgat tccttgcggt ccgaatgggc cgaacccgct

    10561 cgtctggcta agatcggccg cagcgatcgc atccatagcc tccgcgaccg gttgtagaac

    10621 agcgggcagt tcggtttcag gcaggtcttg caacgtgaca ccctgtgcac ggcgggagat

    10681 gcaataggtc aggctctcgc taaactcccc aatgtcaagc acttccggaa tcgggagcgc

    10741 ggccgatgca aagtgccgat aaacataacg atctttgtag aaaccatcgg cgcagctatt

    10801 tacccgcagg acatatccac gccctcctac atcgaagctg aaagcacgag attcttcgcc

    10861 ctccgagagc tgcatcaggt cggagacgct gtcgaacttt tcgatcagaa acttctcgac

    10921 agacgtcgcg gtgagttcag gctttttcat atctcattgc cccccggatc tgcgaaagct

    10981 cgagagagat agatttgtag agagagactg gtgatttcag cgtgtcctct ccaaatgaaa

    11041 tgaacttcct tatatagagg aaggtcttgc gaaggatagt gggattgtgc gtcatccctt

    11101 acgtcagtgg agatatcaca tcaatccact tgctttgaag acgtggttgg aacgtcttct

    11161 ttttccacga tgctcctcgt gggtgggggt ccatctttgg gaccactgtc ggcagaggca

    11221 tcttgaacga tagcctttcc tttatcgcaa tgatggcatt tgtaggtgcc accttccttt

    11281 tctactgtcc ttttgatgaa gtgacagata gctgggcaat ggaatccgag gaggtttccc

    11341 gatattaccc tttgttgaaa agtctcaata gccctttggt cttctgagac tgtatctttg

    11401 atattcttgg agtagacgag agtgtcgtgc tccaccatgt tatcacatca atccacttgc

    11461 tttgaagacg tggttggaac gtcttctttt tccacgatgc tcctcgtggg tgggggtcca

    11521 tctttgggac cactgtcggc agaggcatct tgaacgatag cctttccttt atcgcaatga

    11581 tggcatttgt aggtgccacc ttccttttct actgtccttt tgatgaagtg acagatagct

    11641 gggcaatgga atccgaggag gtttcccgat attacccttt gttgaaaagt ctcaatagcc

    11701 ctttggtctt ctgagactgt atctttgata ttcttggagt agacgagagt gtcgtgctcc

    11761 accatgttgg caagctgctc tagccaatac gcaaaccgcc tctccccgcg cgttggccga

    11821 ttcattaatg cagctggcac gacaggtttc ccgactggaa agcgggcagt gagcgcaacg

    11881 caattaatgt gagttagctc actcattagg caccccaggc tttacacttt atgcttccgg

    11941 ctcgtatgtt gtgtggaatt gtgagcggat aacaatttca cacaggaaac agctatgacc

    12001 atgattac

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart