pDC316

$260.00

  • Model: PVT11041
  • 50 Units in Stock
Ask a question


Add to Cart:

pDC316

Catalog No. PVT11041
Packing 2ug

 

pDC316 Informaiton
pDC316-vector

 

pDC316 Sequence

LOCUS       Exported                3914 bp ds-DNA     circular SYN 24-SEP-2017
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3914)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Sep 24, 2017  
FEATURES             Location/Qualifiers
     source          1..3914
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     misc_feature    complement(11..102)
                     /label=ITR
     misc_signal     190..340
                     /label=Ad5 Psi
                     /note="packaging signal for adenovirus serotype 5"
     misc_feature    469..993
                     /label=MCMV promoter
     misc_feature    994..1029
                     /label=MCS
     polyA_signal    1037..1171
                     /label=SV40 poly(A) signal
                     /note="SV40 polyadenylation signal"
     protein_bind    1191..1224
                     /label=loxP
                     /bound_moiety="Cre recombinase"
                     /note="Cre-mediated recombination occurs in the 8-bp core 
                     sequence (GCATACAT)."
     rep_origin      complement(1648..2236)
                     /direction=LEFT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     CDS             complement(2407..3267)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /label=AmpR
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(3268..3372)
                     /gene="bla"
                     /label=AmpR promoter
     misc_feature    3455..453
                     /label=Ad
     misc_feature    3824..1
                     /label=ITR
ORIGIN
        1 ttcatcaata atatacctta ttttggattg aagccaatat gataatgagg gggtggagtt
       61 tgtgacgtgg cgcggggcgt gggaacgggg cgggtgacgt agtagtgtgg cggaagtgtg
      121 atgttgcaag tgtggcggaa cacatgtaag cgacggatgt ggcaaaagtg acgtttttgg
      181 tgtgcgccgg tgtacacagg aagtgacaat tttcgcgcgg ttttaggcgg atgttgtagt
      241 aaatttgggc gtaaccgagt aagatttggc cattttcgcg ggaaaactga ataagaggaa
      301 gtgaaatctg aataattttg tgttactcat agcgcgtaat atttgtctag ggccgcgggg
      361 actttgaccg tttacgtgga gactcgccca ggtgtttttc tcaggtgttt tccgcgttcc
      421 gggtcaaagt tggcgtttta ttattatagt cagctctaga gatatactga gtcattaggg
      481 actttccaat gggttttgcc cagtacataa ggtcaatagg ggtgaatcaa caggaaagtc
      541 ccattggagc caagtacact gagtcaatag ggactttcca ttgggttttg cccagtacaa
      601 aaggtcaata gggggtgagt caatgggttt ttcccattat tggcacgtac ataaggtcaa
      661 taggggtgag tcattgggtt tttccagcca atttaattaa aacgccatgt actttcccac
      721 cattgacgtc aatgggctat tgaaactaat gcaacgtgac ctttaaacgg tactttccca
      781 tagctgatta atgggaaagt accgttctcg agccaataca cgtcaatggg aagtgaaagg
      841 gcagccaaaa cgtaacaccg ccccggtttt cccctggaaa ttccatattg gcacgcattc
      901 tattggctga gctgcgttct acgtgggtat aagaggcgcg accagcgtcg gtaccgtcgc
      961 agtcttcggt ctgaccaccg tagaacgcag atcgaattcc ccgggagatc taagcttgag
     1021 ctcgtcgact tcgagcaact tgtttattgc agcttataat ggttacaaat aaagcaatag
     1081 catcacaaat ttcacaaata aagcattttt ttcactgcat tctagttgtg gtttgtccaa
     1141 actcatcaat gtatcttatc atgtctggat cgtctagcat cgaagatcca ataacttcgt
     1201 atagcataca ttatacgaag ttataagtag cttggcgtaa tcatggtcat agctgtttcc
     1261 tgtgtgaaat tgttatccgc tcacaattcc acacaacata cgagccggaa gcataaagtg
     1321 taaagcctgg ggtgcctaat gagtgagcta actcacatta attgcgttgc gctcactgcc
     1381 cgctttccag tcgggaaacc tgtcgtgcca gctgcattaa tgaatcggcc aacgcgcggg
     1441 gagaggcggt ttgcgtattg ggcgctcttc cgcttcctcg ctcactgact cgctgcgctc
     1501 ggtcgttcgg ctgcggcgag cggtatcagc tcactcaaag gcggtaatac ggttatccac
     1561 agaatcaggg gataacgcag gaaagaacat gtgagcaaaa ggccagcaaa aggccaggaa
     1621 ccgtaaaaag gccgcgttgc tggcgttttt ccataggctc cgcccccctg acgagcatca
     1681 caaaaatcga cgctcaagtc agaggtggcg aaacccgaca ggactataaa gataccaggc
     1741 gtttccccct ggaagctccc tcgtgcgctc tcctgttccg accctgccgc ttaccggata
     1801 cctgtccgcc tttctccctt cgggaagcgt ggcgctttct caatgctcac gctgtaggta
     1861 tctcagttcg gtgtaggtcg ttcgctccaa gctgggctgt gtgcacgaac cccccgttca
     1921 gcccgaccgc tgcgccttat ccggtaacta tcgtcttgag tccaacccgg taagacacga
     1981 cttatcgcca ctggcagcag ccactggtaa caggattagc agagcgaggt atgtaggcgg
     2041 tgctacagag ttcttgaagt ggtggcctaa ctacggctac actagaagga cagtatttgg
     2101 tatctgcgct ctgctgaagc cagttacctt cggaaaaaga gttggtagct cttgatccgg
     2161 caaacaaacc accgctggta gcggtggttt ttttgtttgc aagcagcaga ttacgcgcag
     2221 aaaaaaagga tctcaagaag atcctttgat cttttctacg gggtctgacg ctcagtggaa
     2281 cgaaaactca cgttaaggga ttttggtcat gagattatca aaaaggatct tcacctagat
     2341 ccttttaaat taaaaatgaa gttttaaatc aatctaaagt atatatgagt aaacttggtc
     2401 tgacagttac caatgcttaa tcagtgaggc acctatctca gcgatctgtc tatttcgttc
     2461 atccatagtt gcctgactcc ccgtcgtgta gataactacg atacgggagg gcttaccatc
     2521 tggccccagt gctgcaatga taccgcgaga cccacgctca ccggctccag atttatcagc
     2581 aataaaccag ccagccggaa gggccgagcg cagaagtggt cctgcaactt tatccgcctc
     2641 catccagtct attaattgtt gccgggaagc tagagtaagt agttcgccag ttaatagttt
     2701 gcgcaacgtt gttgccattg ctacaggcat cgtggtgtca cgctcgtcgt ttggtatggc
     2761 ttcattcagc tccggttccc aacgatcaag gcgagttaca tgatccccca tgttgtgcaa
     2821 aaaagcggtt agctccttcg gtcctccgat cgttgtcaga agtaagttgg ccgcagtgtt
     2881 atcactcatg gttatggcag cactgcataa ttctcttact gtcatgccat ccgtaagatg
     2941 cttttctgtg actggtgagt actcaaccaa gtcattctga gaatagtgta tgcggcgacc
     3001 gagttgctct tgcccggcgt caacacggga taataccgcg ccacatagca gaactttaaa
     3061 agtgctcatc attggaaaac gttcttcggg gcgaaaactc tcaaggatct taccgctgtt
     3121 gagatccagt tcgatgtaac ccactcgtgc acccaactga tcttcagcat cttttacttt
     3181 caccagcgtt tctgggtgag caaaaacagg aaggcaaaat gccgcaa
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart