pDG1730

$260.00

  • Model: PVT11305
  • 50 Units in Stock
Ask a question


Add to Cart:

pDG1730

Catalog No. PVT11305
Packing 2ug
 

pDG1730 Information

Promoter none

Resistance Amp

Screening Erm/Spe

Sensory Stbl3

Culture medium LB

Temperature 37℃

 

pDG1730 Sequence
 

LOCUS       Exported                7602 bp ds-DNA     circular SYN 27-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 7602)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 27, 2017

FEATURES             Location/Qualifiers

     source          1..7602

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             115..693

                     /codon_start=1

                     /label=amyE-front

                     /translation="MFAKRFKTSLLPLFAGFLLLFHLVLAGPAAASAETANKSNELTAP

                     SIKSGTILHAWNWSFNTLKHNMKDIHDAGYTAIQTSPINQVKEGNQGDKSMSNWYWLYQ

                     PTSYQIGNRYLGTEQEFKEMCAAAEEYGIKVIVDAVINHTTSDYAAISNEVKSIPNWTH

                     GNTQIKNWSDRILEAYRIPAALANGDFRS"

     CDS             1039..1713

                     /codon_start=1

                     /label=Spe

                     /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI

                     GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY

                     QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT

                     MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK

                     KL"

     CDS             1849..2868

                     /codon_start=1

                     /label=amyE-back

                     /translation="MSDDDIRLGWAVIASRSGSTPLFFSRPEGGGNGVRFPGKSQIGDR

                     GSALFEDQAITAVNRFHNVMAGQPEELSNPNGNNQIFMNQRGSHGVVLANAGSSSVSIN

                     TATKLPDGRYDNKAGAGSFQVNDGKLTGTINARSVAVLYPDDIAKAPHVFLENYKTGVT

                     HSFNDQLTITLRADANTTKAVYQINNGPDDRRLRMEINSQSEKEIQFGKTYTIMLKGTN

                     SDGVTRTEKYSFVKRDPASAKTIGYQNPNHWSQVNAYIYKHDGSRVIELTGSWPGKPMT

                     KNADGIYTLTLPADTDTTNAKVIFNNGSAQVPGQNQPGFDYVLNGLYNDSGLSGSLPH"

     CDS             4231..4965

                     /codon_start=1

                     /label=Erm

                     /translation="MNEKNIKHSQNFITSKHNIDKIMTNIRLNEHDNIFEIGSGKGHFT

                     LELVKRCNFVTAIEIDHKLCKTTENKLVDHDNFQVLNKDILQFKFPKNQSYKIYGNIPY

                     NISTDIIRKIVFDSIANEIYLIVEYGFAKRLLNTKRSLALLLMAEVDISILSMVPREYF

                     HPKPKVNSSLIRLSRKKSRISHKDKQKYNYFVMKWVNKEYKKIFTKNQFNNSLKHAGID

                     DLNNISFEQFLSLFNSYKLFNK"

     rep_origin      complement(5773..6361)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(6532..7392)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

ORIGIN

        1 aacaaaattc tccagtcttc acatcggttt gaaaggagga agcggaagaa tgaagtaaga

       61 gggatttttg actccgaagt aagtcttcaa aaaatcaaat aaggagtgtc aagaatgttt

      121 gcaaaacgat tcaaaacctc tttactgccg ttattcgctg gatttttatt gctgtttcat

      181 ttggttctgg caggaccggc ggctgcgagt gctgaaacgg cgaacaaatc gaatgagctt

      241 acagcaccgt cgatcaaaag cggaaccatt cttcatgcat ggaattggtc gttcaatacg

      301 ttaaaacaca atatgaagga tattcatgat gcaggatata cagccattca gacatctccg

      361 attaaccaag taaaggaagg gaatcaagga gataaaagca tgtcgaactg gtactggctg

      421 tatcagccga catcgtatca aattggcaac cgttacttag gtactgaaca agaatttaaa

      481 gaaatgtgtg cagccgctga agaatatggc ataaaggtca ttgttgacgc ggtcatcaat

      541 cataccacca gtgattatgc cgcgatttcc aatgaggtta agagtattcc aaactggaca

      601 catggaaaca cacaaattaa aaactggtct gatcggatcc tagaagctta tcgaattcct

      661 gcagccctgg cgaatggcga ttttcgttcg tgaatacatg ttataataac tataactaat

      721 aacgtaacgt gactggcaag agatattttt aaaacaatga ataggtttac acttacttta

      781 gttttatgga aatgaaagat catatcatat ataatctaga ataaaattaa ctaaaataat

      841 tattatctag ataaaaaatt tagaagccaa tgaaatctat aaataaacta aattaagttt

      901 atttaattaa caactatgga tataaaatag gtactaatca aaatagtgag gaggatatat

      961 ttgaatacat acgaacaaat taataaagtg aaaaaaatac ttcggaaaca tttaaaaaat

     1021 aaccttattg gtacttacat gtttggatca ggagttgaga gtggactaaa accaaatagt

     1081 gatcttgact ttttagtcgt cgtatctgaa ccattgacag atcaaagtaa agaaatactt

     1141 atacaaaaaa ttagacctat ttcaaaaaaa ataggagata aaagcaactt acgatatatt

     1201 gaattaacaa ttattattca gcaagaaatg gtaccgtgga atcatcctcc caaacaagaa

     1261 tttatttatg gagaatggtt acaagagctt tatgaacaag gatacattcc tcagaaggaa

     1321 ttaaattcag atttaaccat aatgctttac caagcaaaac gaaaaaataa aagaatatac

     1381 ggaaattatg acttagagga attactacct gatattccat tttctgatgt gagaagagcc

     1441 attatggatt cgtcagagga attaatagat aattatcagg atgatgaaac caactctata

     1501 ttaactttat gccgtatgat tttaactatg gacacgggta aaatcatacc aaaagatatt

     1561 gcgggaaatg cagtggctga atcttctcca ttagaacata gggagagaat tttgttagca

     1621 gttcgtagtt atcttggaga gaatattgaa tggactaatg aaaatgtaaa tttaactata

     1681 aactatttaa ataacagatt aaaaaaatta taaaaaaatt gaaaaaatgg tggaaacact

     1741 tttttcaatt tttttgtttt attatttaat atttgggaaa tattcattct aattggtaat

     1801 cagattttag aaaacaataa acccttgcat agggggatct cgacatggat gagcgatgat

     1861 gatatccgtt taggctgggc ggtgatagct tctcgttcag gcagtacgcc tcttttcttt

     1921 tccagacctg agggaggcgg aaatggtgtg aggttcccgg ggaaaagcca aataggcgat

     1981 cgcgggagtg ctttatttga agatcaggct atcactgcgg tcaatagatt tcacaatgtg

     2041 atggctggac agcctgagga actctcgaac ccgaatggaa acaaccagat atttatgaat

     2101 cagcgcggct cacatggcgt tgtgctggca aatgcaggtt catcctctgt ctctatcaat

     2161 acggcaacaa aattgcctga tggcaggtat gacaataaag ctggagcggg ttcatttcaa

     2221 gtgaacgatg gtaaactgac aggcacgatc aatgccaggt ctgtagctgt gctttatcct

     2281 gatgatattg caaaagcgcc tcatgttttc cttgagaatt acaaaacagg tgtaacacat

     2341 tctttcaatg atcaactgac gattaccttg cgtgcagatg cgaatacaac aaaagccgtt

     2401 tatcaaatca ataatggacc agacgacagg cgtttaagga tggagatcaa ttcacaatcg

     2461 gaaaaggaga tccaatttgg caaaacatac accatcatgt taaaaggaac gaacagtgat

     2521 ggtgtaacga ggaccgagaa atacagtttt gttaaaagag atccagcgtc ggccaaaacc

     2581 atcggctatc aaaatccgaa tcattggagc caggtaaatg cttatatcta taaacatgat

     2641 gggagccgag taattgaatt gaccggatct tggcctggaa aaccaatgac taaaaatgca

     2701 gacggaattt acacgctgac gctgcctgcg gacacggata caaccaacgc aaaagtgatt

     2761 tttaataatg gcagcgccca agtgcccggt cagaatcagc ctggctttga ttacgtgcta

     2821 aatggtttat ataatgactc gggcttaagc ggttctcttc cccattgagg gcaaggctag

     2881 acgggactta ccgaaagaaa ccatcaatga tggtttcttt tttgttcata aatcagacaa

     2941 aacttttctc ttgcaaaagt ttgtgaagtg ttgcacaata taaatgtgaa atacttcaca

     3001 aacaaaaaga catcaaagag aaacataccc tgcaaggatg ctgatattgt ctgcatttgc

     3061 gccggagcaa accaaaaacc tggtgagaca cgccttgaat tagtagaaaa gaacttgaag

     3121 attttcaaag gcatcgttag tgaagtcatg gcgagcggat ttgacggcat tttcttagtc

     3181 gcgacgcgag gctggatggc cttccccatt atgattcttc tcgcttccgg cggcatcggg

     3241 atgcccgcgt tgcaggccat gctgtccagg caggtagatg acgaccatca gggacagctt

     3301 caaggatcgc tcgcggctct taccagccta acttcgatca ctggaccgct gatcgtcacg

     3361 gcgatttatg ccgcctcggc gagcacatgg aacgggttgg catggattgt aggcgccgcc

     3421 ctataccttg tctgcctccc cgcgttgcgt cgcggtgcat ggagccgggc cacctactga

     3481 agtggatttc tttaagagct cctttaactt cctcaccagt agttgtatcg gtaccataag

     3541 tagaagcagc aacccaagta gctttaccag catccggttc aaccagcata gtaagaatct

     3601 tactggacat cggcagttct tcgaacagtg cgccaactac cagctctttc tgcagttcat

     3661 tcagggcacc ggagaacctg cgtgcaatcc atcttgttca atcatgcgaa acgatcctca

     3721 tcctgtctct tgatccatgg attacgcgtt aacccgggcc cgcggatgca tatgatcaga

     3781 tcctttaact ctggcaaccc tcaaaattga atgagacatg ctacacctcc ggataataaa

     3841 tatatataaa cgtatataga tttcataaag tctaacacac tagacttatt tacttcgtaa

     3901 ttaagtcgtt aaaccgtgtg ctctacgacc aaaactataa aacctttaag aactttcttt

     3961 ttttacaaga aaaaagaaat tagataaatc tctcatatct tttattcaat aatcgcatcc

     4021 gattgcagta taaatttaac gatcactcat catgttcata tttatcagag ctcgtgctat

     4081 aattatacta attttataag gaggaaaaaa tatgggcatt tttagtattt ttgtaatcag

     4141 cacagttcat tatcaaccaa acaaaaaata agtggttata atgaatcgtt aataagcaaa

     4201 attcatataa ccaaattaaa gagggttata atgaacgaga aaaatataaa acacagtcaa

     4261 aactttatta cttcaaaaca taatatagat aaaataatga caaatataag attaaatgaa

     4321 catgataata tctttgaaat cggctcagga aaaggccatt ttacccttga attagtaaag

     4381 aggtgtaatt tcgtaactgc cattgaaata gaccataaat tatgcaaaac tacagaaaat

     4441 aaacttgttg atcacgataa tttccaagtt ttaaacaagg atatattgca gtttaaattt

     4501 cctaaaaacc aatcctataa aatatatggt aatatacctt ataacataag tacggatata

     4561 atacgcaaaa ttgtttttga tagtatagct aatgagattt atttaatcgt ggaatacggg

     4621 tttgctaaaa gattattaaa tacaaaacgc tcattggcat tacttttaat ggcagaagtt

     4681 gatatttcta tattaagtat ggttccaaga gaatattttc atcctaaacc taaagtgaat

     4741 agctcactta tcagattaag tagaaaaaaa tcaagaatat cacacaaaga taaacaaaag

     4801 tataattatt tcgttatgaa atgggttaac aaagaataca agaaaatatt tacaaaaaat

     4861 caatttaaca attccttaaa acatgcagga attgacgatt taaacaatat tagctttgaa

     4921 caattcttat ctcttttcaa tagctataaa ttatttaata agtaagttaa gggatgcata

     4981 aactgcatcc cttaacttgt ttttcgtgtg cctatttttt gtgaatcgat tatgtctttt

     5041 gcgcagtcgg cttaaaccag ttttcgctgg tgcgaaaaaa gagtgtcttg tgacacctaa

     5101 attcaaaatc tatcggtcag atttataccg atttgatttt atatattctt gaataacata

     5161 cgccgagtta tcacataaaa gcgggaacca atcatcaaat ttaaacttca ttgcataatc

     5221 cattaaactc ttaaattcta cgattccttg ttcatcaata aactcaatca tttctttaat

     5281 taatttatat ctatctgttg ttgttttctt taataattca tcaacatcta caccgccata

     5341 aactatcata tcttcttttt gatatttaaa tttattagga tcttaaggcc taggtctaga

     5401 gtctttgttt tgacgccatt agcgtacgta acaatcctcg ttaaaggaca aggacctgag

     5461 cggaagtgta tcgtacagta gacggagtat actagtatag tctatagtcc gtggaattat

     5521 tatatttatc tccgacgata ttctcatcag tgaaatccag ctggagttct ttagcaaatt

     5581 tttttattag ctgaacttag tattagtggc catactcctc caatccaaag ctatttagaa

     5641 agattactat atcctcaaac aggcggtaac cggcctcttc atcgggaatg cgcgcgacct

     5701 tcagcatcgc cggcatgtcc ccctggcgga cgggaagtat ccagctcgag gtcgggccgc

     5761 gttgctggcg tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc

     5821 aagtcagagg tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag

     5881 ctccctcgtg cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct

     5941 cccttcggga agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta

     6001 ggtcgttcgc tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc

     6061 cttatccggt aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc

     6121 agcagccact ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt

     6181 gaagtggtgg cctaactacg gctacactag aaggacagta tttggtatct gcgctctgct

     6241 gaagccagtt accttcggaa aaagagttga tagctcttga tccggcaaac aaaccaccgc

     6301 tggtagcggt ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca

     6361 agaagatcct ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta

     6421 agggattttg gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa

     6481 atgaagtttt aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg

     6541 cttaatcagt gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg

     6601 actccccgtc gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc

     6661 aatgataccg cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc

     6721 cggaagggcc gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa

     6781 ttgttgccgg gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc

     6841 cattgctgca ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg

     6901 ttcccaacga tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc

     6961 cttcggtcct ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat

     7021 ggcagcactg cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg

     7081 tgagtactca accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc

     7141 ggcgtcaaca cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg

     7201 aaaacgttct tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat

     7261 gtaacccact cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg

     7321 gtgagcaaaa acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg

     7381 ttgaatactc atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct

     7441 catgagcgga tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac

     7501 atttccccga aaagtgccac ctgacgtcta agaaaccatt attatcatga cattaaccta

     7561 taaaaatagg cgtatcacga ggccctttcg tcttcaagaa tt

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart