pDONR221- Zeo

$193.00

  • Model: PVT11148
  • 50 Units in Stock
Ask a question


Add to Cart:

pDONR221-Zeo


Catalog No. PVT11148
Packing 2ug
Function plant expression plasmid
Resistance Zeo
Screen /
Strain DB3.1
Culture temperature 37degrees centigrade
Replicon
Copy
Promoter T7
Induction
Forward primer M13F
Reverse primer M13R

 

pDONR221/ Zeo Sequence

LOCUS       Exported                4291 bp ds-DNA     circular SYN 19-SEP-2016

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    Untitled

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4291)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Monday, September 19, 2016 from SnapGene Viewer 3.2.1

    

FEATURES             Location/Qualifiers

     source          1..4291

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      268..295

                     /note="rrnB T2 terminator"

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     terminator      387..473

                     /gene="Escherichia coli rrnB"

                     /note="rrnB T1 terminator"

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     primer_bind     537..553

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    570..801

                     /gene="mutant version of attP"

                     /bound_moiety="BP Clonase(TM)"

                     /note="attP1"

                     /note="recombination site for the Gateway(R) BP reaction"

     CDS             complement(1197..1502)

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /note="ccdB"

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     CDS             complement(1847..2506)

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /note="CmR"

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     promoter        complement(2507..2609)

                     /note="cat promoter"

                     /note="promoter of the E. coli cat gene encoding 

                     chloramphenicol acetyltransferase"

     protein_bind    complement(2754..2985)

                     /gene="mutant version of attP"

                     /bound_moiety="BP Clonase(TM)"

                     /note="attP2"

                     /note="recombination site for the Gateway(R) BP reaction"

     promoter        complement(3004..3022)

                     /note="T7 promoter"

                     /note="promoter for bacteriophage T7 RNA polymerase"

     primer_bind     complement(3027..3043)

                     /note="M13 rev"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             complement(3111..3485)

                     /codon_start=1

                     /gene="Sh ble from Streptoalloteichus hindustanus"

                     /product="antibiotic-binding protein"

                     /note="BleoR"

                     /note="confers resistance to bleomycin, phleomycin, and 

                     Zeocin(TM)"

                     /translation="MAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRDD

                     VTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWGR

                     EFALRDPAGNCVHFVAEEQD"

     promoter        complement(3504..3551)

                     /note="EM7 promoter"

                     /note="synthetic bacterial promoter "

     rep_origin      3641..4229

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgcctttg agtgagctga

       61 taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga

      121 gcgcccaata cgcaaaccgc ctctccccgc gcgttggccg attcattaat gcagctggca

      181 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaata cgcgtaccgc

      241 tagccaggaa gagtttgtag aaacgcaaaa aggccatccg tcaggatggc cttctgctta

      301 gtttgatgcc tggcagttta tggcgggcgt cctgcccgcc accctccggg ccgttgcttc

      361 acaacgttca aatccgctcc cggcggattt gtcctactca ggagagcgtt caccgacaaa

      421 caacagataa aacgaaaggc ccagtcttcc gactgagcct ttcgttttat ttgatgcctg

      481 gcagttccct actctcgcgt taacgctagc atggatgttt tcccagtcac gacgttgtaa

      541 aacgacggcc agtcttaagc tcgggcccca aataatgatt ttattttgac tgatagtgac

      601 ctgttcgttg caacacattg atgagcaatg cttttttata atgccaactt tgtacaaaaa

      661 agctgaacga gaaacgtaaa atgatataaa tatcaatata ttaaattaga ttttgcataa

      721 aaaacagact acataatact gtaaaacaca acatatccag tcactatgaa tcaactactt

      781 agatggtatt agtgacctgt agtcgaccga cagccttcca aatgttcttc gggtgatgct

      841 gccaacttag tcgaccgaca gccttccaaa tgttcttctc aaacggaatc gtcgtatcca

      901 gcctactcgc tattgtcctc aatgccgtat taaatcataa aaagaaataa gaaaaagagg

      961 tgcgagcctc ttttttgtgt gacaaaataa aaacatctac ctattcatat acgctagtgt

     1021 catagtcctg aaaatcatct gcatcaagaa caatttcaca actcttatac ttttctctta

     1081 caagtcgttc ggcttcatct ggattttcag cctctatact tactaaacgt gataaagttt

     1141 ctgtaatttc tactgtatcg acctgcagac tggctgtgta taagggagcc tgacatttat

     1201 attccccaga acatcaggtt aatggcgttt ttgatgtcat tttcgcggtg gctgagatca

     1261 gccacttctt ccccgataac ggagaccggc acactggcca tatcggtggt catcatgcgc

     1321 cagctttcat ccccgatatg caccaccggg taaagttcac gggagacttt atctgacagc

     1381 agacgtgcac tggccagggg gatcaccatc cgtcgcccgg gcgtgtcaat aatatcactc

     1441 tgtacatcca caaacagacg ataacggctc tctcttttat aggtgtaaac cttaaactgc

     1501 atttcaccag cccctgttct cgtcagcaaa agagccgttc atttcaataa accgggcgac

     1561 ctcagccatc ccttcctgat tttccgcttt ccagcgttcg gcacgcagac gacgggcttc

     1621 attctgcatg gttgtgctta ccagaccgga gatattgaca tcatatatgc cttgagcaac

     1681 tgatagctgt cgctgtcaac tgtcactgta atacgctgct tcatagcata cctctttttg

     1741 acatacttcg ggtatacata tcagtatata ttcttatacc gcaaaaatca gcgcgcaaat

     1801 acgcatactg ttatctggct tttagtaagc cggatccacg cggcgtttac gccccgccct

     1861 gccactcatc gcagtactgt tgtaattcat taagcattct gccgacatgg aagccatcac

     1921 agacggcatg atgaacctga atcgccagcg gcatcagcac cttgtcgcct tgcgtataat

     1981 atttgcccat ggtgaaaacg ggggcgaaga agttgtccat attggccacg tttaaatcaa

     2041 aactggtgaa actcacccag ggattggctg agacgaaaaa catattctca ataaaccctt

     2101 tagggaaata ggccaggttt tcaccgtaac acgccacatc ttgcgaatat atgtgtagaa

     2161 actgccggaa atcgtcgtgg tattcactcc agagcgatga aaacgtttca gtttgctcat

     2221 ggaaaacggt gtaacaaggg tgaacactat cccatatcac cagctcaccg tctttcattg

     2281 ccatacggaa ttccggatga gcattcatca ggcgggcaag aatgtgaata aaggccggat

     2341 aaaacttgtg cttatttttc tttacggtct ttaaaaaggc cgtaatatcc agctgaacgg

     2401 tctggttata ggtacattga gcaactgact gaaatgcctc aaaatgttct ttacgatgcc

     2461 attgggatat atcaacggtg gtatatccag tgattttttt ctccatttta gcttccttag

     2521 ctcctgaaaa tctcgataac tcaaaaaata cgcccggtag tgatcttatt tcattatggt

     2581 gaaagttgga acctcttacg tgccgatcaa cgtctcattt tcgccaaaag ttggcccagg

     2641 gcttcccggt atcaacaggg acaccaggat ttatttattc tgcgaagtga tcttccgtca

     2701 caggtattta ttcggcgcaa agtgcgtcgg gtgatgctgc caacttagtc gactacaggt

     2761 cactaatacc atctaagtag ttgattcata gtgactggat atgttgtgtt ttacagtatt

     2821 atgtagtctg ttttttatgc aaaatctaat ttaatatatt gatatttata tcattttacg

     2881 tttctcgttc agctttcttg tacaaagttg gcattataag aaagcattgc ttatcaattt

     2941 gttgcaacga acaggtcact atcagtcaaa ataaaatcat tatttgccat ccagctgata

     3001 tcccctatag tgagtcgtat tacatggtca tagctgtttc ctggcagctc tggcccgtgt

     3061 ctcaaaatct ctgatgttac attgcacaag ataaaataat atcatcatga tcagtcctgc

     3121 tcctcggcca cgaagtgcac gcagttgccg gccgggtcgc gcagggcgaa ctcccgcccc

     3181 cacggctgct cgccgatctc ggtcatggcc ggcccggagg cgtcccggaa gttcgtggac

     3241 acgacctccg accactcggc gtacagctcg tccaggccgc gcacccacac ccaggccagg

     3301 gtgttgtccg gcaccacctg gtcctggacc gcgctgatga acagggtcac gtcgtcccgg

     3361 accacaccgg cgaagtcgtc ctccacgaag tcccgggaga acccgagccg gtcggtccag

     3421 aactcgaccg ctccggcgac gtcgcgcgcg gtgagcaccg gaacggcact ggtcaacttg

     3481 gccatggttt agttcctcac cttgtcgtat tatactatgc cgatatacta tgccgatgat

     3541 taattgtcaa cacgtgctga tcatgaccaa aatcccttaa cgtgagttac gcgtcgttcc

     3601 actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc

     3661 gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg

     3721 atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa

     3781 atactgttct tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc

     3841 ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt

     3901 gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa

     3961 cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc

     4021 tacagcgtga gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc

     4081 cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct

     4141 ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat

     4201 gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc

     4261 tggccttttg ctggcctttt gctcacatgt t

//
 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart