pDsRed2- Nuc Plasmid

$216.00

  • Model: PVT1217
  • 50 Units in Stock
Ask a question


Add to Cart:

pDsRed2-Nuc

Search name

pDsRed2-Nuc,Plasmid pDsRed2-Nuc,pDsRed2-Nuc vector

 

pDsRed2-Nuc Information

Promoter: CMV

Replicator: pUC ori, F1 ori

Terminator: SV40 poly (A) signal

Plasmid classification: mammalian cells, fluorescent protein reporter vectors

Plasmid size: 4711bp

Prokaryotic resistance: Kan

Screening markers: Neo

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: Sv40-polyA-R:GAAATTTGTGATGCTATTGC

 

pDsRed2-Nuc Description

pDsRed2-Nuc is a mammalian expression vector that encodes Discosoma sp. red fluorescent protein (DsRed2; 1, 2) fused with three copies of the nuclear localization signal (NLS) of the simian virus 40 large T-antigen (3, 4). The NLS sequences are fused to the 3'-end of DsRed2—a human codon-optimized DsRed variant engineered for faster maturation and lower non-specific aggregation (1, 5). The reiteration of the NLS sequence significantly increases the efficiency with which the DsRed2 fusion translocates into the nucleus of mammalian cells

pDsRed2-Nuc

 

 

pDsRed2-Nuc Sequence

LOCUS       Exported                4711 bp ds-DNA    circular SYN 18-10-2015
DEFINITION  .
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 7
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 4711)
  AUTHORS   admin
  TITLE     Direct Submission
  JOURNAL   Exported 2015-10-18   
FEATURES             Location/Qualifiers
     source          1..4711
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        59..362
                     /note="CMV enhancer"
                     /note="human cytomegalovirus immediate early enhancer"
     promoter        363..566
                     /note="CMV promoter"
                     /note="human cytomegalovirus (CMV) immediate early 
                     promoter"
     CDS             611..1285
                     /codon_start=1
                     /product="improved tetrameric variant of DsRed fluorescent 
                     protein"
                     /note="DsRed2"
                     /note="mammalian codon-optimized"
                     /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK
                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV
                     ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK
                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH
                     LFL"
     CDS             1301..1321
                     /codon_start=1
                     /locus_tag="
                     "
                     /product="nuclear localization signal of SV40 large T 
                     antigen"
                     /note="SV40 NLS"
                     /note="
                     "
                     /protein_id="
                     "
                     /translation="PKKKRKV"
     CDS             1325..1345
                     /codon_start=1
                     /locus_tag="
                     "
                     /product="nuclear localization signal of SV40 large T 
                     antigen"
                     /note="SV40 NLS"
                     /note="
                     "
                     /protein_id="
                     "
                     /translation="PKKKRKV"
     CDS             1349..1369
                     /codon_start=1
                     /locus_tag="
                     "
                     /product="nuclear localization signal of SV40 large T 
                     antigen"
                     /note="SV40 NLS"
                     /note="
                     "
                     /protein_id="
                     "
                     /translation="PKKKRKV"
     polyA_signal    1499..1620
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
     rep_origin      complement(1627..2082)
                     /direction=LEFT
                     /note="f1 ori"
                     /note="f1 bacteriophage origin of replication; arrow 
                     indicates direction of (+) strand synthesis"
     promoter        2109..2213
                     /gene="bla"
                     /note="AmpR promoter"
     promoter        2215..2572
                     /note="SV40 promoter"
                     /note="SV40 enhancer and early promoter"
     rep_origin      2423..2558
                     /note="SV40 ori"
                     /note="SV40 origin of replication"
     CDS             2607..3401
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /note="NeoR/KanR"
                     /note="confers resistance to neomycin, kanamycin, and G418 
                     (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    3633..3680
                     /note="HSV TK poly(A) signal"
                     /note="herpesvirus thymidine kinase polyadenylation signal"
     rep_origin      4009..4597
                     /direction=RIGHT
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart