pEarleyGate 301

$193.00

  • Model: PVT11165
  • 50 Units in Stock
Ask a question


Add to Cart:

pEarleyGate 301


Catalog No. PVT11165
Packing 2ug

 

pEarleyGate 301 Information

Function plant expression plasmid

Terminator: OCS Terminator

Plasmid tagging: C-HA

Prokaryotic resistance: kanamycin Kan

Screening marker: Bar

Clone strain: Escherichia coli DB3.1

Culture conditions: 37 C

 

pEarleyGate 301 Description

PEarleyGate 301 (C-HA) is a Gateway expression system for plant cells. pEarleyGate 301 allows for rapid recombinational cloning of DNA from Gateway entry vectors to be epitope tagged with HA tag at the C-terminus of the encoded protein. This vector allows for expression of genes from a promoter of choice rather than from the enhanced 35S promoter (see pEarleyGate 101-105 or 201-204).

 

pEarleyGate 301 Sequence

LOCUS       Exported               10379 bp ds-DNA     circular SYN 18-DEC-2017

DEFINITION  Gateway(R)-compatible promoterless plant transformation vector with 

            a C-terminal HA tag.

KEYWORDS    pEarleyGate 301

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 10379)

  AUTHORS   Earley KW, Haag JR, Pontes O, Opper K, Juehne T, Song K, Pikaard CS.

  TITLE     Gateway-compatible vectors for plant functional genomics and 

            proteomics.

  JOURNAL   Plant J. 2006;45:616-29.

  PUBMED    16441352

REFERENCE   2  (bases 1 to 10379)

  AUTHORS   Pikaard Lab

  TITLE     Direct Submission

COMMENT     The sequence was corrected by inserting a G at position 6487.

FEATURES             Location/Qualifiers

     source          1..10379

                     /organism="synthetic DNA construct"

                     /lab_host="Plant Cells"

                     /mol_type="other DNA"

     misc_feature    3..27

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     terminator      113..365

                     /label=MAS terminator

                     /note="mannopine synthase terminator"

     CDS             complement(375..926)

                     /codon_start=1

                     /gene="Streptomyces hygroscopicus bar"

                     /product="phosphinothricin acetyltransferase"

                     /label=Bar

                     /note="confers resistance to bialophos or phosphinothricin"

                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE

                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS

                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF

                     WQLDFSLPVPPRPVLPVTEI"

     promoter        complement(932..1312)

                     /label=MAS promoter

                     /note="mannopine synthase promoter (Velten et al., 1984)"

     protein_bind    1364..1483

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        1513..1543

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             1597..2256

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=Chl

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             2598..2903

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(2944..3068)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             3070..3096

                     /codon_start=1

                     /product="HA (human influenza hemagglutinin) epitope tag"

                     /label=HA

                     /translation="YPYDVPDYA"

     terminator      3150..3857

                     /label=OCS terminator

                     /note="octopine synthase terminator"

     misc_feature    4101..4125

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             5425..6054

                     /codon_start=1

                     /product="stability protein from Pseudomonas plasmid pVS1"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             6483..7556

                     /codon_start=1

                     /product="replication protein from Pseudomonas plasmid 

                     pVS1"

                     /label=pVS1 RepA

                     /translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW

                     QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS

                     KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP

                     GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE

                     ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR

                     LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI

                     LVMRYRNLIEGEASAGS"

     rep_origin      7622..7816

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    8160..8300

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(8486..9074)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(9161..9955)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=Kan

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

ORIGIN

        1 gctggcagga tatattgtgg tgtaaacaaa ttgacgctta gacaacttaa taacacattg

       61 cggacgtttt taatgtactg aattaacgcc gaattaattc gagctcggat ctgataattt

      121 atttgaaaat tcataagaaa agcaaacgtt acatgaattg atgaaacaat acaaagacag

      181 ataaagccac gcacatttag gatattggcc gagattactg aatattgagt aagatcacgg

      241 aatttctgac aggagcatgt cttcaattca gcccaaatgg cagttgaaat actcaaaccg

      301 ccccatatgc aggagcggat cattcattgt ttgtttggtt gcctttgcca acatgggagt

      361 ccaagattct gcagtcaaat ctcggtgacg ggcaggaccg gacggggcgg taccggcagg

      421 ctgaagtcca gctgccagaa acccacgtca tgccagttcc cgtgcttgaa gccggccgcc

      481 cgcagcatgc cgcggggggc atatccgagc gcctcgtgca tgcgcacgct cgggtcgttg

      541 ggcagcccga tgacagcgac cacgctcttg aagccctgtg cctccaggga cttcagcagg

      601 tgggtgtaga gcgtggagcc cagtcccgtc cgctggtggc ggggggagac gtacacggtc

      661 gactcggccg tccagtcgta ggcgttgcgt gccttccagg ggcccgcgta ggcgatgccg

      721 gcgacctcgc cgtccacctc ggcgacgagc cagggatagc gctcccgcag acggacgagg

      781 tcgtccgtcc actcctgcgg ttcctgcggc tcggtacgga agttgaccgt gcttgtctcg

      841 atgtagtggt tgacgatggt gcagaccgcc ggcatgtccg cctcggtggc acggcggatg

      901 tcggccgggc gtcgttctgg gctcatcgat tcgatttggt gtatcgagat tggttatgaa

      961 attcagatgc tagtgtaatg tattggtaat ttgggaagat ataataggaa gcaaggctat

     1021 ttatccattt ctgaaaaggc gaaatggcgt caccgcgagc gtcacgcgca ttccgttctt

     1081 gctgtaaagc gttgtttggt acacttttga ctagcgaggc ttggcgtgtc agcgtatcta

     1141 ttcaaaagtc gttaatggct gcggatcaag aaaaagttgg aatagaaaca gaatacccgc

     1201 gaaattcagg cccggttgcc atgtcctaca cgccgaaata aacgaccaaa ttagtagaaa

     1261 aataaaaact gactcggata cttacgtcac gtcttgcgca ctgatttgaa aaatctcaga

     1321 attgaattct gcagtcgacg gtaccgcggg cccgggatca tcaacaagtt tgtacaaaaa

     1381 agctgaacga gaaacgtaaa atgatataaa tatcaatata ttaaattaga ttttgcataa

     1441 aaaacagact acataatact gtaaaacaca acatatccag tcatattggc ggccgcatta

     1501 ggcaccccag gctttacact ttatgcttcc ggctcgtata atgtgtggat tttgagttag

     1561 gatccgtcga gattttcagg agctaaggaa gctaaaatgg agaaaaaaat cactggatat

     1621 accaccgttg atatatccca atggcatcgt aaagaacatt ttgaggcatt tcagtcagtt

     1681 gctcaatgta cctataacca gaccgttcag ctggatatta cggccttttt aaagaccgta

     1741 aagaaaaata agcacaagtt ttatccggcc tttattcaca ttcttgcccg cctgatgaat

     1801 gctcatccgg aattccgtat ggcaatgaaa gacggtgagc tggtgatatg ggatagtgtt

     1861 cacccttgtt acaccgtttt ccatgagcaa actgaaacgt tttcatcgct ctggagtgaa

     1921 taccacgacg atttccggca gtttctacac atatattcgc aagatgtggc gtgttacggt

     1981 gaaaacctgg cctatttccc taaagggttt attgagaata tgtttttcgt ctcagccaat

     2041 ccctgggtga gtttcaccag ttttgattta aacgtggcca atatggacaa cttcttcgcc

     2101 cccgttttca ccatgggcaa atattatacg caaggcgaca aggtgctgat gccgctggcg

     2161 attcaggttc atcatgccgt ttgtgatggc ttccatgtcg gcagaatgct taatgaatta

     2221 caacagtact gcgatgagtg gcagggcggg gcgtaaacgc gtggatccgg cttactaaaa

     2281 gccagataac agtatgcgta tttgcgcgct gatttttgcg gtataagaat atatactgat

     2341 atgtataccc gaagtatgtc aaaaagaggt atgctatgaa gcagcgtatt acagtgacag

     2401 ttgacagcga cagctatcag ttgctcaagg catatatgat gtcaatatct ccggtctggt

     2461 aagcacaacc atgcagaatg aagcccgtcg tctgcgtgcc gaacgctgga aagcggaaaa

     2521 tcaggaaggg atggctgagg tcgcccggtt tattgaaatg aacggctctt ttgctgacga

     2581 gaacaggggc tggtgaaatg cagtttaagg tttacaccta taaaagagag agccgttatc

     2641 gtctgtttgt ggatgtacag agtgatatta ttgacacgcc cgggcgacgg atggtgatcc

     2701 ccctggccag tgcacgtctg ctgtcagata aagtctcccg tgaactttac ccggtggtgc

     2761 atatcgggga tgaaagctgg cgcatgatga ccaccgatat ggccagtgtg ccggtctccg

     2821 ttatcgggga agaagtggct gatctcagcc accgcgaaaa tgacatcaaa aacgccatta

     2881 acctgatgtt ctggggaata taaatgtcag gctcccttat acacagccag tctgcaggtc

     2941 gaccatagtg actggatatg ttgtgtttta cagcattatg tagtctgttt tttatgcaaa

     3001 atctaattta atatattgat atttatatca ttttacgttt ctcgttcagc tttcttgtac

     3061 aaagtggtgt acccatacga tgttccagat tacgcttgac taggtgagtc tagagagtta

     3121 attaagaccc gggactagtc cctagagtcc tgctttaatg agatatgcga gacgcctatg

     3181 atcgcatgat atttgctttc aattctgttg tgcacgttgt aaaaaacctg agcatgtgta

     3241 gctcagatcc ttaccgccgg tttcggttca ttctaatgaa tatatcaccc gttactatcg

     3301 tatttttatg aataatattc tccgttcaat ttactgattg taccctacta cttatatgta

     3361 caatattaaa atgaaaacaa tatattgtgc tgaataggtt tatagcgaca tctatgatag

     3421 agcgccacaa taacaaacaa ttgcgtttta ttattacaaa tccaatttta aaaaaagcgg

     3481 cagaaccggt caaacctaaa agactgatta cataaatctt attcaaattt caaaagtgcc

     3541 ccaggggcta gtatctacga cacaccgagc ggcgaactaa taacgctcac tgaagggaac

     3601 tccggttccc cgccggcgcg catgggtgag attccttgaa gttgagtatt ggccgtccgc

     3661 tctaccgaaa gttacgggca ccattcaacc cggtccagca cggcggccgg gtaaccgact

     3721 tgctgccccg agaattatgc agcatttttt tggtgtatgt gggccccaaa tgaagtgcag

     3781 gtcaaacctt gacagtgacg acaaatcgtt gggcgggtcc agggcgaatt ttgcgacaac

     3841 atgtcgaggc tcagcaggac ctgcaggcat gcaagcttgg cactggccgt cgttttacaa

     3901 cgtcgtgact gggaaaaccc tggcgttacc caacttaatc gccttgcagc acatccccct

     3961 ttcgccagct ggcgtaatag cgaagaggcc cgcaccgatc gcccttccca acagttgcgc

     4021 agcctgaatg gcgaatgcta gagcagcttg agcttggatc agattgtcgt ttcccgcctt

     4081 cagtttaaac tatcagtgtt tgacaggata tattggcggg taaacctaag agaaaagagc

     4141 gtttattaga ataacggata tttaaaaggg cgtgaaaagg tttatccgtt cgtccatttg

     4201 tatgtgcatg ccaaccacag ggttcccctc gggatcaaag tactttgatc caacccctcc

     4261 gctgctatag tgcagtcggc ttctgacgtt cagtgcagcc gtcttctgaa aacgacatgt

     4321 cgcacaagtc ctaagttacg cgacaggctg ccgccctgcc cttttcctgg cgttttcttg

     4381 tcgcgtgttt tagtcgcata aagtagaata cttgcgacta gaaccggaga cattacgcca

     4441 tgaacaagag cgccgccgct ggcctgctgg gctatgcccg cgtcagcacc gacgaccagg

     4501 acttgaccaa ccaacgggcc gaactgcacg cggccggctg caccaagctg ttttccgaga

     4561 agatcaccgg caccaggcgc gaccgcccgg agctggccag gatgcttgac cacctacgcc

     4621 ctggcgacgt tgtgacagtg accaggctag accgcctggc ccgcagcacc cgcgacctac

     4681 tggacattgc cgagcgcatc caggaggccg gcgcgggcct gcgtagcctg gcagagccgt

     4741 gggccgacac caccacgccg gccggccgca tggtgttgac cgtgttcgcc ggcattgccg

     4801 agttcgagcg ttccctaatc atcgaccgca cccggagcgg gcgcgaggcc gccaaggccc

     4861 gaggcgtgaa gtttggcccc cgccctaccc tcaccccggc acagatcgcg cacgcccgcg

     4921 agctgatcga ccaggaaggc cgcaccgtga aagaggcggc tgcactgctt ggcgtgcatc

     4981 gctcgaccct gtaccgcgca cttgagcgca gcgaggaagt gacgcccacc gaggccaggc

     5041 ggcgcggtgc cttccgtgag gacgcattga ccgaggccga cgccctggcg gccgccgaga

     5101 atgaacgcca agaggaacaa gcatgaaacc gcaccaggac ggccaggacg aaccgttttt

     5161 cattaccgaa gagatcgagg cggagatgat cgcggccggg tacgtgttcg agccgcccgc

     5221 gcacgtctca accgtgcggc tgcatgaaat cctggccggt ttgtctgatg ccaagctggc

     5281 ggcctggccg gccagcttgg ccgctgaaga aaccgagcgc cgccgtctaa aaaggtgatg

     5341 tgtatttgag taaaacagct tgcgtcatgc ggtcgctgcg tatatgatgc gatgagtaaa

     5401 taaacaaata cgcaagggga acgcatgaag gttatcgctg tacttaacca gaaaggcggg

     5461 tcaggcaaga cgaccatcgc aacccatcta gcccgcgccc tgcaactcgc cggggccgat

     5521 gttctgttag tcgattccga tccccagggc agtgcccgcg attgggcggc cgtgcgggaa

     5581 gatcaaccgc taaccgttgt cggcatcgac cgcccgacga ttgaccgcga cgtgaaggcc

     5641 atcggccggc gcgacttcgt agtgatcgac ggagcgcccc aggcggcgga cttggctgtg

     5701 tccgcgatca aggcagccga cttcgtgctg attccggtgc agccaagccc ttacgacata

     5761 tgggccaccg ccgacctggt ggagctggtt aagcagcgca ttgaggtcac ggatggaagg

     5821 ctacaagcgg cctttgtcgt gtcgcgggcg atcaaaggca cgcgcatcgg cggtgaggtt

     5881 gccgaggcgc tggccgggta cgagctgccc attcttgagt cccgtatcac gcagcgcgtg

     5941 agctacccag gcactgccgc cgccggcaca accgttcttg aatcagaacc cgagggcgac

     6001 gctgcccgcg aggtccaggc gctggccgct gaaattaaat caaaactcat ttgagttaat

     6061 gaggtaaaga gaaaatgagc aaaagcacaa acacgctaag tgccggccgt ccgagcgcac

     6121 gcagcagcaa ggctgcaacg ttggccagcc tggcagacac gccagccatg aagcgggtca

     6181 actttcagtt gccggcggag gatcacacca agctgaagat gtacgcggta cgccaaggca

     6241 agaccattac cgagctgcta tctgaataca tcgcgcagct accagagtaa atgagcaaat

     6301 gaataaatga gtagatgaat tttagcggct aaaggaggcg gcatggaaaa tcaagaacaa

     6361 ccaggcaccg acgccgtgga atgccccatg tgtggaggaa cgggcggttg gccaggcgta

     6421 agcggctggg ttgtctgccg gccctgcaat ggcactggaa cccccaagcc cgaggaatcg

     6481 gcgtgagcgg tcgcaaacca tccggcccgg tacaaatcgg cgcggcgctg ggtgatgacc

     6541 tggtggagaa gttgaaggcc gcgcaggccg cccagcggca acgcatcgag gcagaagcac

     6601 gccccggtga atcgtggcaa gcggccgctg atcgaatccg caaagaatcc cggcaaccgc

     6661 cggcagccgg tgcgccgtcg attaggaagc cgcccaaggg cgacgagcaa ccagattttt

     6721 tcgttccgat gctctatgac gtgggcaccc gcgatagtcg cagcatcatg gacgtggccg

     6781 ttttccgtct gtcgaagcgt gaccgacgag ctggcgaggt gatccgctac gagcttccag

     6841 acgggcacgt agaggtttcc gcagggccgg ccggcatggc cagtgtgtgg gattacgacc

     6901 tggtactgat ggcggtttcc catctaaccg aatccatgaa ccgataccgg gaagggaagg

     6961 gagacaagcc cggccgcgtg ttccgtccac acgttgcgga cgtactcaag ttctgccggc

     7021 gagccgatgg cggaaagcag aaagacgacc tggtagaaac ctgcattcgg ttaaacacca

     7081 cgcacgttgc catgcagcgt acgaagaagg ccaagaacgg ccgcctggtg acggtatccg

     7141 agggtgaagc cttgattagc cgctacaaga tcgtaaagag cgaaaccggg cggccggagt

     7201 acatcgagat cgagctagct gattggatgt accgcgagat cacagaaggc aagaacccgg

     7261 acgtgctgac ggttcacccc gattactttt tgatcgatcc cggcatcggc cgttttctct

     7321 accgcctggc acgccgcgcc gcaggcaagg cagaagccag atggttgttc aagacgatct

     7381 acgaacgcag tggcagcgcc ggagagttca agaagttctg tttcaccgtg cgcaagctga

     7441 tcgggtcaaa tgacctgccg gagtacgatt tgaaggagga ggcggggcag gctggcccga

     7501 tcctagtcat gcgctaccgc aacctgatcg agggcgaagc atccgccggt tcctaatgta

     7561 cggagcagat gctagggcaa attgccctag caggggaaaa aggtcgaaaa ggtctctttc

     7621 ctgtggatag cacgtacatt gggaacccaa agccgtacat tgggaaccgg aacccgtaca

     7681 ttgggaaccc aaagccgtac attgggaacc ggtcacacat gtaagtgact gatataaaag

     7741 agaaaaaagg cgatttttcc gcctaaaact ctttaaaact tattaaaact cttaaaaccc

     7801 gcctggcctg tgcataactg tctggccagc gcacagccga agagctgcaa aaagcgccta

     7861 cccttcggtc gctgcgctcc ctacgccccg ccgcttcgcg tcggcctatc gcggccgctg

     7921 gccgctcaaa aatggctggc ctacggccag gcaatctacc agggcgcgga caagccgcgc

     7981 cgtcgccact cgaccgccgg cgcccacatc aaggcaccct gcctcgcgcg tttcggtgat

     8041 gacggtgaaa acctctgaca catgcagctc ccggagacgg tcacagcttg tctgtaagcg

     8101 gatgccggga gcagacaagc ccgtcagggc gcgtcagcgg gtgttggcgg gtgtcggggc

     8161 gcagccatga cccagtcacg tagcgatagc ggagtgtata ctggcttaac tatgcggcat

     8221 cagagcagat tgtactgaga gtgcaccata tgcggtgtga aataccgcac agatgcgtaa

     8281 ggagaaaata ccgcatcagg cgctcttccg cttcctcgct cactgactcg ctgcgctcgg

     8341 tcgttcggct gcggcgagcg gtatcagctc actcaaaggc ggtaatacgg ttatccacag

     8401 aatcagggga taacgcagga aagaacatgt gagcaaaagg ccagcaaaag gccaggaacc

     8461 gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg cccccctgac gagcatcaca

     8521 aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg actataaaga taccaggcgt

     8581 ttccccctgg aagctccctc gtgcgctctc ctgttccgac cctgccgctt accggatacc

     8641 tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca tagctcacgc tgtaggtatc

     8701 tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt gcacgaaccc cccgttcagc

     8761 ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggta agacacgact

     8821 tatcgccact ggcagcagcc actggtaaca ggattagcag agcgaggtat gtaggcggtg

     8881 ctacagagtt cttgaagtgg tggcctaact acggctacac tagaaggaca gtatttggta

     8941 tctgcgctct gctgaagcca gttaccttcg gaaaaagagt tggtagctct tgatccggca

     9001 aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa gcagcagatt acgcgcagaa

     9061 aaaaaggatc tcaagaagat cctttgatct tttctacggg gtctgacgct cagtggaacg

     9121 aaaactcacg ttaagggatt ttggtcatgc attctaggta ctaaaacaat tcatccagta

     9181 aaatataata ttttattttc tcccaatcag gcttgatccc cagtaagtca aaaaatagct

     9241 cgacatactg ttcttccccg atatcctccc tgatcgaccg gacgcagaag gcaatgtcat

     9301 accacttgtc cgccctgccg cttctcccaa gatcaataaa gccacttact ttgccatctt

     9361 tcacaaagat gttgctgtct cccaggtcgc cgtgggaaaa gacaagttcc tcttcgggct

     9421 tttccgtctt taaaaaatca tacagctcgc gcggatcttt aaatggagtg tcttcttccc

     9481 agttttcgca atccacatcg gccagatcgt tattcagtaa gtaatccaat tcggctaagc

     9541 ggctgtctaa gctattcgta tagggacaat ccgatatgtc gatggagtga aagagcctga

     9601 tgcactccgc atacagctcg ataatctttt cagggctttg ttcatcttca tactcttccg

     9661 agcaaaggac gccatcggcc tcactcatga gcagattgct ccagccatca tgccgttcaa

     9721 agtgcaggac ctttggaaca ggcagctttc cttccagcca tagcatcatg tccttttccc

     9781 gttccacatc ataggtggtc cctttatacc ggctgtccgt catttttaaa tataggtttt

     9841 cattttctcc caccagctta tataccttag caggagacat tccttccgta tcttttacgc

     9901 agcggtattt ttcgatcagt tttttcaatt ccggtgatat tctcatttta gccatttatt

     9961 atttccttcc tcttttctac agtatttaaa gataccccaa gaagctaatt ataacaagac

    10021 gaactccaat tcactgttcc ttgcattcta aaaccttaaa taccagaaaa cagctttttc

    10081 aaagttgttt tcaaagttgg cgtataacat agtatcgacg gagccgattt tgaaaccgcg

    10141 gtgatcacag gcagcaacgc tctgtcatcg ttacaatcaa catgctaccc tccgcgagat

    10201 catccgtgtt tcaaacccgg cagcttagtt gccgttcttc cgaatagcat cggtaacatg

    10261 agcaaagtct gccgccttac aacggctctc ccgctgacgc cgtcccggac tgatgggctg

    10321 cctgtatcga gtggtgattt tgtgccgagc tgccggtcgg ggagctgttg gctggctgg

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart