pEarleyGate 302

$215.00

  • Model: PVT11166
  • 50 Units in Stock
Ask a question


Add to Cart:

pEarleyGate 302


Catalog No. PVT11166                           Packing 2ug

 

pEarleyGate 302 Information

Alternative name: perelleygate302

Promoter: 35S

Replicon: pVS1

Prokaryotic resistance: Kan

Filter tag: Bar

Clone strain: DB3.1

Culture condition: 37 ℃

Host: plant

Application of vector: protein expression

Gene species: empty body

Gene type: ORF, gateway

Prokaryotic resistance: Kan

Eukaryotic resistance: Bar

Function plant expression plasmid

 

pEarleyGate 302 Sequence

LOCUS       Exported               10376 bp ds-DNA     circular SYN 24-SEP-2017

DEFINITION  synthetic circular DNA

ACCESSION   .

VERSION     .

KEYWORDS    .

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 10376)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported Sep 24, 2017

FEATURES             Location/Qualifiers

     source          1..10376

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    3..27

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     terminator      113..365

                     /label=MAS terminator

                     /note="mannopine synthase terminator"

     CDS             complement(375..926)

                     /codon_start=1

                     /gene="Streptomyces hygroscopicus bar"

                     /product="phosphinothricin acetyltransferase"

                     /label=Bar

                     /note="confers resistance to bialophos or phosphinothricin"

                     /translation="MSPERRPADIRRATEADMPAVCTIVNHYIETSTVNFRTEPQEPQE

                     WTDDLVRLRERYPWLVAEVDGEVAGIAYAGPWKARNAYDWTAESTVYVSPRHQRTGLGS

                     TLYTHLLKSLEAQGFKSVVAVIGLPNDPSVRMHEALGYAPRGMLRAAGFKHGNWHDVGF

                     WQLDFSLPVPPRPVLPVTEI"

     promoter        complement(932..1312)

                     /label=MAS promoter

                     /note="mannopine synthase promoter (Velten et al., 1984)"

     protein_bind    1364..1488

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        1513..1543

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             1597..2256

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             2598..2903

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(2944..3068)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             3070..3093

                     /codon_start=1

                     /product="FLAG(R) epitope tag, followed by an enterokinase 

                     cleavage site"

                     /label=FLAG

                     /translation="DYKDDDDK"

     terminator      3147..3854

                     /label=OCS terminator

                     /note="octopine synthase terminator"

     misc_feature    4098..4122

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             5422..6051

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             6480..7553

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW

                     QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS

                     KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP

                     GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE

                     ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR

                     LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI

                     LVMRYRNLIEGEASAGS"

     rep_origin      7619..7813

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    8157..8297

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(8483..9071)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(9158..9952)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

ORIGIN

        1 gctggcagga tatattgtgg tgtaaacaaa ttgacgctta gacaacttaa taacacattg

       61 cggacgtttt taatgtactg aattaacgcc gaattaattc gagctcggat ctgataattt

      121 atttgaaaat tcataagaaa agcaaacgtt acatgaattg atgaaacaat acaaagacag

      181 ataaagccac gcacatttag gatattggcc gagattactg aatattgagt aagatcacgg

      241 aatttctgac aggagcatgt cttcaattca gcccaaatgg cagttgaaat actcaaaccg

      301 ccccatatgc aggagcggat cattcattgt ttgtttggtt gcctttgcca acatgggagt

      361 ccaagattct gcagtcaaat ctcggtgacg ggcaggaccg gacggggcgg taccggcagg

      421 ctgaagtcca gctgccagaa acccacgtca tgccagttcc cgtgcttgaa gccggccgcc

      481 cgcagcatgc cgcggggggc atatccgagc gcctcgtgca tgcgcacgct cgggtcgttg

      541 ggcagcccga tgacagcgac cacgctcttg aagccctgtg cctccaggga cttcagcagg

      601 tgggtgtaga gcgtggagcc cagtcccgtc cgctggtggc ggggggagac gtacacggtc

      661 gactcggccg tccagtcgta ggcgttgcgt gccttccagg ggcccgcgta ggcgatgccg

      721 gcgacctcgc cgtccacctc ggcgacgagc cagggatagc gctcccgcag acggacgagg

      781 tcgtccgtcc actcctgcgg ttcctgcggc tcggtacgga agttgaccgt gcttgtctcg

      841 atgtagtggt tgacgatggt gcagaccgcc ggcatgtccg cctcggtggc acggcggatg

      901 tcggccgggc gtcgttctgg gctcatcgat tcgatttggt gtatcgagat tggttatgaa

      961 attcagatgc tagtgtaatg tattggtaat ttgggaagat ataataggaa gcaaggctat

     1021 ttatccattt ctgaaaaggc gaaatggcgt caccgcgagc gtcacgcgca ttccgttctt

     1081 gctgtaaagc gttgtttggt acacttttga ctagcgaggc ttggcgtgtc agcgtatcta

     1141 ttcaaaagtc gttaatggct gcggatcaag aaaaagttgg aatagaaaca gaatacccgc

     1201 gaaattcagg cccggttgcc atgtcctaca cgccgaaata aacgaccaaa ttagtagaaa

     1261 aataaaaact gactcggata cttacgtcac gtcttgcgca ctgatttgaa aaatctcaga

     1321 attgaattct gcagtcgacg gtaccgcggg cccgggatca tcaacaagtt tgtacaaaaa

     1381 agctgaacga gaaacgtaaa atgatataaa tatcaatata ttaaattaga ttttgcataa

     1441 aaaacagact acataatact gtaaaacaca acatatccag tcatattggc ggccgcatta

     1501 ggcaccccag gctttacact ttatgcttcc ggctcgtata atgtgtggat tttgagttag

     1561 gatccgtcga gattttcagg agctaaggaa gctaaaatgg agaaaaaaat cactggatat

     1621 accaccgttg atatatccca atggcatcgt aaagaacatt ttgaggcatt tcagtcagtt

     1681 gctcaatgta cctataacca gaccgttcag ctggatatta cggccttttt aaagaccgta

     1741 aagaaaaata agcacaagtt ttatccggcc tttattcaca ttcttgcccg cctgatgaat

     1801 gctcatccgg aattccgtat ggcaatgaaa gacggtgagc tggtgatatg ggatagtgtt

     1861 cacccttgtt acaccgtttt ccatgagcaa actgaaacgt tttcatcgct ctggagtgaa

     1921 taccacgacg atttccggca gtttctacac atatattcgc aagatgtggc gtgttacggt

     1981 gaaaacctgg cctatttccc taaagggttt attgagaata tgtttttcgt ctcagccaat

     2041 ccctgggtga gtttcaccag ttttgattta aacgtggcca atatggacaa cttcttcgcc

     2101 cccgttttca ccatgggcaa atattatacg caaggcgaca aggtgctgat gccgctggcg

     2161 attcaggttc atcatgccgt ttgtgatggc ttccatgtcg gcagaatgct taatgaatta

     2221 caacagtact gcgatgagtg gcagggcggg gcgtaaacgc gtggatccgg cttactaaaa

     2281 gccagataac agtatgcgta tttgcgcgct gatttttgcg gtataagaat atatactgat

     2341 atgtataccc gaagtatgtc aaaaagaggt atgctatgaa gcagcgtatt acagtgacag

     2401 ttgacagcga cagctatcag ttgctcaagg catatatgat gtcaatatct ccggtctggt

     2461 aagcacaacc atgcagaatg aagcccgtcg tctgcgtgcc gaacgctgga aagcggaaaa

     2521 tcaggaaggg atggctgagg tcgcccggtt tattgaaatg aacggctctt ttgctgacga

     2581 gaacaggggc tggtgaaatg cagtttaagg tttacaccta taaaagagag agccgttatc

     2641 gtctgtttgt ggatgtacag agtgatatta ttgacacgcc cgggcgacgg atggtgatcc

     2701 ccctggccag tgcacgtctg ctgtcagata aagtctcccg tgaactttac ccggtggtgc

     2761 atatcgggga tgaaagctgg cgcatgatga ccaccgatat ggccagtgtg ccggtctccg

     2821 ttatcgggga agaagtggct gatctcagcc accgcgaaaa tgacatcaaa aacgccatta

     2881 acctgatgtt ctggggaata taaatgtcag gctcccttat acacagccag tctgcaggtc

     2941 gaccatagtg actggatatg ttgtgtttta cagcattatg tagtctgttt tttatgcaaa

     3001 atctaattta atatattgat atttatatca ttttacgttt ctcgttcagc tttcttgtac

     3061 aaagtggtgg actacaaaga cgatgacgac aaatgactag gtgagtctag agagttaatt

     3121 aagacccggg actagtccct agagtcctgc tttaatgaga tatgcgagac gcctatgatc

     3181 gcatgatatt tgctttcaat tctgttgtgc acgttgtaaa aaacctgagc atgtgtagct

     3241 cagatcctta ccgccggttt cggttcattc taatgaatat atcacccgtt actatcgtat

     3301 ttttatgaat aatattctcc gttcaattta ctgattgtac cctactactt atatgtacaa

     3361 tattaaaatg aaaacaatat attgtgctga ataggtttat agcgacatct atgatagagc

     3421 gccacaataa caaacaattg cgttttatta ttacaaatcc aattttaaaa aaagcggcag

     3481 aaccggtcaa acctaaaaga ctgattacat aaatcttatt caaatttcaa aagtgcccca

     3541 ggggctagta tctacgacac accgagcggc gaactaataa cgctcactga agggaactcc

     3601 ggttccccgc cggcgcgcat gggtgagatt ccttgaagtt gagtattggc cgtccgctct

     3661 accgaaagtt acgggcacca ttcaacccgg tccagcacgg cggccgggta accgacttgc

     3721 tgccccgaga attatgcagc atttttttgg tgtatgtggg ccccaaatga agtgcaggtc

     3781 aaaccttgac agtgacgaca aatcgttggg cgggtccagg gcgaattttg cgacaacatg

     3841 tcgaggctca gcaggacctg caggcatgca agcttggcac tggccgtcgt tttacaacgt

     3901 cgtgactggg aaaaccctgg cgttacccaa cttaatcgcc ttgcagcaca tccccctttc

     3961 gccagctggc gtaatagcga agaggcccgc accgatcgcc cttcccaaca gttgcgcagc

     4021 ctgaatggcg aatgctagag cagcttgagc ttggatcaga ttgtcgtttc ccgccttcag

     4081 tttaaactat cagtgtttga caggatatat tggcgggtaa acctaagaga aaagagcgtt

     4141 tattagaata acggatattt aaaagggcgt gaaaaggttt atccgttcgt ccatttgtat

     4201 gtgcatgcca accacagggt tcccctcggg atcaaagtac tttgatccaa cccctccgct

     4261 gctatagtgc agtcggcttc tgacgttcag tgcagccgtc ttctgaaaac gacatgtcgc

     4321 acaagtccta agttacgcga caggctgccg ccctgccctt ttcctggcgt tttcttgtcg

     4381 cgtgttttag tcgcataaag tagaatactt gcgactagaa ccggagacat tacgccatga

     4441 acaagagcgc cgccgctggc ctgctgggct atgcccgcgt cagcaccgac gaccaggact

     4501 tgaccaacca acgggccgaa ctgcacgcgg ccggctgcac caagctgttt tccgagaaga

     4561 tcaccggcac caggcgcgac cgcccggagc tggccaggat gcttgaccac ctacgccctg

     4621 gcgacgttgt gacagtgacc aggctagacc gcctggcccg cagcacccgc gacctactgg

     4681 acattgccga gcgcatccag gaggccggcg cgggcctgcg tagcctggca gagccgtggg

     4741 ccgacaccac cacgccggcc ggccgcatgg tgttgaccgt gttcgccggc attgccgagt

     4801 tcgagcgttc cctaatcatc gaccgcaccc ggagcgggcg cgaggccgcc aaggcccgag

     4861 gcgtgaagtt tggcccccgc cctaccctca ccccggcaca gatcgcgcac gcccgcgagc

     4921 tgatcgacca ggaaggccgc accgtgaaag aggcggctgc actgcttggc gtgcatcgct

     4981 cgaccctgta ccgcgcactt gagcgcagcg aggaagtgac gcccaccgag gccaggcggc

     5041 gcggtgcctt ccgtgaggac gcattgaccg aggccgacgc cctggcggcc gccgagaatg

     5101 aacgccaaga ggaacaagca tgaaaccgca ccaggacggc caggacgaac cgtttttcat

     5161 taccgaagag atcgaggcgg agatgatcgc ggccgggtac gtgttcgagc cgcccgcgca

     5221 cgtctcaacc gtgcggctgc atgaaatcct ggccggtttg tctgatgcca agctggcggc

     5281 ctggccggcc agcttggccg ctgaagaaac cgagcgccgc cgtctaaaaa ggtgatgtgt

     5341 atttgagtaa aacagcttgc gtcatgcggt cgctgcgtat atgatgcgat gagtaaataa

     5401 acaaatacgc aaggggaacg catgaaggtt atcgctgtac ttaaccagaa aggcgggtca

     5461 ggcaagacga ccatcgcaac ccatctagcc cgcgccctgc aactcgccgg ggccgatgtt

     5521 ctgttagtcg attccgatcc ccagggcagt gcccgcgatt gggcggccgt gcgggaagat

     5581 caaccgctaa ccgttgtcgg catcgaccgc ccgacgattg accgcgacgt gaaggccatc

     5641 ggccggcgcg acttcgtagt gatcgacgga gcgccccagg cggcggactt ggctgtgtcc

     5701 gcgatcaagg cagccgactt cgtgctgatt ccggtgcagc caagccctta cgacatatgg

     5761 gccaccgccg acctggtgga gctggttaag cagcgcattg aggtcacgga tggaaggcta

     5821 caagcggcct ttgtcgtgtc gcgggcgatc aaaggcacgc gcatcggcgg tgaggttgcc

     5881 gaggcgctgg ccgggtacga gctgcccatt cttgagtccc gtatcacgca gcgcgtgagc

     5941 tacccaggca ctgccgccgc cggcacaacc gttcttgaat cagaacccga gggcgacgct

     6001 gcccgcgagg tccaggcgct ggccgctgaa attaaatcaa aactcatttg agttaatgag

     6061 gtaaagagaa aatgagcaaa agcacaaaca cgctaagtgc cggccgtccg agcgcacgca

     6121 gcagcaaggc tgcaacgttg gccagcctgg cagacacgcc agccatgaag cgggtcaact

     6181 ttcagttgcc ggcggaggat cacaccaagc tgaagatgta cgcggtacgc caaggcaaga

     6241 ccattaccga gctgctatct gaatacatcg cgcagctacc agagtaaatg agcaaatgaa

     6301 taaatgagta gatgaatttt agcggctaaa ggaggcggca tggaaaatca agaacaacca

     6361 ggcaccgacg ccgtggaatg ccccatgtgt ggaggaacgg gcggttggcc aggcgtaagc

     6421 ggctgggttg tctgccggcc ctgcaatggc actggaaccc ccaagcccga ggaatcggcg

     6481 tgagcggtcg caaaccatcc ggcccggtac aaatcggcgc ggcgctgggt gatgacctgg

     6541 tggagaagtt gaaggccgcg caggccgccc agcggcaacg catcgaggca gaagcacgcc

     6601 ccggtgaatc gtggcaagcg gccgctgatc gaatccgcaa agaatcccgg caaccgccgg

     6661 cagccggtgc gccgtcgatt aggaagccgc ccaagggcga cgagcaacca gattttttcg

     6721 ttccgatgct ctatgacgtg ggcacccgcg atagtcgcag catcatggac gtggccgttt

     6781 tccgtctgtc gaagcgtgac cgacgagctg gcgaggtgat ccgctacgag cttccagacg

     6841 ggcacgtaga ggtttccgca gggccggccg gcatggccag tgtgtgggat tacgacctgg

     6901 tactgatggc ggtttcccat ctaaccgaat ccatgaaccg ataccgggaa gggaagggag

     6961 acaagcccgg ccgcgtgttc cgtccacacg ttgcggacgt actcaagttc tgccggcgag

     7021 ccgatggcgg aaagcagaaa gacgacctgg tagaaacctg cattcggtta aacaccacgc

     7081 acgttgccat gcagcgtacg aagaaggcca agaacggccg cctggtgacg gtatccgagg

     7141 gtgaagcctt gattagccgc tacaagatcg taaagagcga aaccgggcgg ccggagtaca

     7201 tcgagatcga gctagctgat tggatgtacc gcgagatcac agaaggcaag aacccggacg

     7261 tgctgacggt tcaccccgat tactttttga tcgatcccgg catcggccgt tttctctacc

     7321 gcctggcacg ccgcgccgca ggcaaggcag aagccagatg gttgttcaag acgatctacg

     7381 aacgcagtgg cagcgccgga gagttcaaga agttctgttt caccgtgcgc aagctgatcg

     7441 ggtcaaatga cctgccggag tacgatttga aggaggaggc ggggcaggct ggcccgatcc

     7501 tagtcatgcg ctaccgcaac ctgatcgagg gcgaagcatc cgccggttcc taatgtacgg

     7561 agcagatgct agggcaaatt gccctagcag gggaaaaagg tcgaaaaggt ctctttcctg

     7621 tggatagcac gtacattggg aacccaaagc cgtacattgg gaaccggaac ccgtacattg

     7681 ggaacccaaa gccgtacatt gggaaccggt cacacatgta agtgactgat ataaaagaga

     7741 aaaaaggcga tttttccgcc taaaactctt taaaacttat taaaactctt aaaacccgcc

     7801 tggcctgtgc ataactgtct ggccagcgca cagccgaaga gctgcaaaaa gcgcctaccc

     7861 ttcggtcgct gcgctcccta cgccccgccg cttcgcgtcg gcctatcgcg gccgctggcc

     7921 gctcaaaaat ggctggccta cggccaggca atctaccagg gcgcggacaa gccgcgccgt

     7981 cgccactcga ccgccggcgc ccacatcaag gcaccctgcc tcgcgcgttt cggtgatgac

     8041 ggtgaaaacc tctgacacat gcagctcccg gagacggtca cagcttgtct gtaagcggat

     8101 gccgggagca gacaagcccg tcagggcgcg tcagcgggtg ttggcgggtg tcggggcgca

     8161 gccatgaccc agtcacgtag cgatagcgga gtgtatactg gcttaactat gcggcatcag

     8221 agcagattgt actgagagtg caccatatgc ggtgtgaaat accgcacaga tgcgtaagga

     8281 gaaaataccg catcaggcgc tcttccgctt cctcgctcac tgactcgctg cgctcggtcg

     8341 ttcggctgcg gcgagcggta tcagctcact caaaggcggt aatacggtta tccacagaat

     8401 caggggataa cgcaggaaag aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta

     8461 aaaaggccgc gttgctggcg tttttccata ggctccgccc ccctgacgag catcacaaaa

     8521 atcgacgctc aagtcagagg tggcgaaacc cgacaggact ataaagatac caggcgtttc

     8581 cccctggaag ctccctcgtg cgctctcctg ttccgaccct gccgcttacc ggatacctgt

     8641 ccgcctttct cccttcggga agcgtggcgc tttctcatag ctcacgctgt aggtatctca

     8701 gttcggtgta ggtcgttcgc tccaagctgg gctgtgtgca cgaacccccc gttcagcccg

     8761 accgctgcgc cttatccggt aactatcgtc ttgagtccaa cccggtaaga cacgacttat

     8821 cgccactggc agcagccact ggtaacagga ttagcagagc gaggtatgta ggcggtgcta

     8881 cagagttctt gaagtggtgg cctaactacg gctacactag aaggacagta tttggtatct

     8941 gcgctctgct gaagccagtt accttcggaa aaagagttgg tagctcttga tccggcaaac

     9001 aaaccaccgc tggtagcggt ggtttttttg tttgcaagca gcagattacg cgcagaaaaa

     9061 aaggatctca agaagatcct ttgatctttt ctacggggtc tgacgctcag tggaacgaaa

     9121 actcacgtta agggattttg gtcatgcatt ctaggtacta aaacaattca tccagtaaaa

     9181 tataatattt tattttctcc caatcaggct tgatccccag taagtcaaaa aatagctcga

     9241 catactgttc ttccccgata tcctccctga tcgaccggac gcagaaggca atgtcatacc

     9301 acttgtccgc cctgccgctt ctcccaagat caataaagcc acttactttg ccatctttca

     9361 caaagatgtt gctgtctccc aggtcgccgt gggaaaagac aagttcctct tcgggctttt

     9421 ccgtctttaa aaaatcatac agctcgcgcg gatctttaaa tggagtgtct tcttcccagt

     9481 tttcgcaatc cacatcggcc agatcgttat tcagtaagta atccaattcg gctaagcggc

     9541 tgtctaagct attcgtatag ggacaatccg atatgtcgat ggagtgaaag agcctgatgc

     9601 actccgcata cagctcgata atcttttcag ggctttgttc atcttcatac tcttccgagc

     9661 aaaggacgcc atcggcctca ctcatgagca gattgctcca gccatcatgc cgttcaaagt

     9721 gcaggacctt tggaacaggc agctttcctt ccagccatag catcatgtcc ttttcccgtt

     9781 ccacatcata ggtggtccct ttataccggc tgtccgtcat ttttaaatat aggttttcat

     9841 tttctcccac cagcttatat accttagcag gagacattcc ttccgtatct tttacgcagc

     9901 ggtatttttc gatcagtttt ttcaattccg gtgatattct cattttagcc atttattatt

     9961 tccttcctct tttctacagt atttaaagat accccaagaa gctaattata acaagacgaa

    10021 ctccaattca ctgttccttg cattctaaaa ccttaaatac cagaaaacag ctttttcaaa

    10081 gttgttttca aagttggcgt ataacatagt atcgacggag ccgattttga aaccgcggtg

    10141 atcacaggca gcaacgctct gtcatcgtta caatcaacat gctaccctcc gcgagatcat

    10201 ccgtgtttca aacccggcag cttagttgcc gttcttccga atagcatcgg taacatgagc

    10261 aaagtctgcc gccttacaac ggctctcccg ctgacgccgt cccggactga tgggctgcct

    10321 gtatcgagtg gtgattttgt gccgagctgc cggtcgggga gctgttggct ggctgg

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart