pEGFP- HRH1

$260.00

  • Model: PVT10349
  • 50 Units in Stock
Ask a question


Add to Cart:

pEGFP-HRH1


Catalog No. PVT10349
Packing 2ug

 

pEGFP-HRH1 Information
Function ORF expression plasmid
Resistance Kan
Screen Neo/G418
Strain DH5alpha
Culture temperature 37degrees centigrade

 

pEGFP-HRH1 Sequence

LOCUS       Exported                6197 bp ds-DNA     circular SYN 29-SEP-2017
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    pEGFP-HRH1
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6197)
  AUTHORS   admin
  TITLE     Direct Submission
FEATURES             Location/Qualifiers
     source          1..6197
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     enhancer        61..364
                     /label=CMV enhancer
                     /note="CMV enhancer;human cytomegalovirus immediate early 
                     enhancer"
     promoter        365..568
                     /label=CMV promoter
                     /note="CMV promoter;human cytomegalovirus (CMV) immediate 
                     early promoter"
     misc_feature    619..624
                     /label=Kozak
     misc_feature    625..2085
                     /label=HRH1
                     /note="Homo sapiens histamine receptor H1 (HRH1), 
                     transcript variant 4, mRNA
                     NCBI Reference Sequence: NM_000861.3"
     CDS             2143..2862
                     /codon_start=1
                     /product="enhanced GFP"
                     /label=EGFP
                     /note="EGFP;mammalian codon-optimized"
                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL
                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD
                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK
                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL
                     EFVTAAGITLGMDELYK"
     polyA_signal    2985..3106
                     /label=SV40 poly(A) signal
                     /note="SV40 poly(A) signal;SV40 polyadenylation signal"
     rep_origin      complement(3113..3568)
                     /direction=LEFT
                     /label=f1 ori
                     /note="f1 ori;f1 bacteriophage origin of replication; arrow
                     indicates direction of (+) strand synthesis"
     promoter        3595..3699
                     /gene="bla"
                     /label=bla AmpR promoter
                     /note="AmpR promoter"
     promoter        3701..4058
                     /label=SV40 promoter
                     /note="SV40 promoter;SV40 enhancer and early promoter"
     rep_origin      3909..4044
                     /label=SV40 ori
                     /note="SV40 ori;SV40 origin of replication"
     CDS             4093..4887
                     /codon_start=1
                     /gene="aph(3')-II (or nptII)"
                     /product="aminoglycoside phosphotransferase from Tn5"
                     /label=NeoR/KanR
                     /note="NeoR/KanR;confers resistance to neomycin, kanamycin,
                     and G418 (Geneticin(R))"
                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP
                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS
                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ
                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA
                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"
     polyA_signal    5119..5166
                     /label=HSV TK poly(A) signal
                     /note="HSV TK poly(A) signal;herpesvirus thymidine kinase 
                     polyadenylation signal"
     rep_origin      5495..6083
                     /direction=RIGHT
                     /label=ori
                     /note="ori;high-copy-number ColE1/pMB1/pBR322/pUC origin of
                     replication"
ORIGIN
        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg
       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt
      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca
      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc
      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta
      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac
      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg
      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg
      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt
      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta
      601 ccggactcag atctcgaggc caccatgagc ctccccaatt cctcctgcct cttagaagac
      661 aagatgtgtg agggcaacaa gaccactatg gccagccccc agctgatgcc cctggtggtg
      721 gtcctgagca ctatctgctt ggtcacagta gggctcaacc tgctggtgct gtatgccgta
      781 cggagtgagc ggaagctcca cactgtgggg aacctgtaca tcgtcagcct ctcggtggcg
      841 gacttgatcg tgggtgccgt cgtcatgcct atgaacatcc tctacctgct catgtccaag
      901 tggtcactgg gccgtcctct ctgcctcttt tggctttcca tggactatgt ggccagcaca
      961 gcgtccattt tcagtgtctt catcctgtgc attgatcgct accgctctgt ccagcagccc
     1021 ctcaggtacc ttaagtatcg taccaagacc cgagcctcgg ccaccattct gggggcctgg
     1081 tttctctctt ttctgtgggt tattcccatt ctaggctgga atcacttcat gcagcagacc
     1141 tcggtgcgcc gagaggacaa gtgtgagaca gacttctatg atgtcacctg gttcaaggtc
     1201 atgactgcca tcatcaactt ctacctgccc accttgctca tgctctggtt ctatgccaag
     1261 atctacaagg ccgtacgaca acactgccag caccgggagc tcatcaatag gtccctccct
     1321 tccttctcag aaattaagct gaggccagag aaccccaagg gggatgccaa gaaaccaggg
     1381 aaggagtctc cctgggaggt tctgaaaagg aagccaaaag atgctggtgg tggatctgtc
     1441 ttgaagtcac catcccaaac ccccaaggag atgaaatccc cagttgtctt cagccaagag
     1501 gatgatagag aagtagacaa actctactgc tttccacttg atattgtgca catgcaggct
     1561 gcggcagagg ggagtagcag ggactatgta gccgtcaacc ggagccatgg ccagctcaag
     1621 acagatgagc agggcctgaa cacacatggg gccagcgaga tatcagagga tcagatgtta
     1681 ggtgatagcc aatccttctc tcgaacggac tcagatacca ccacagagac agcaccaggc
     1741 aaaggcaaat tgaggagtgg gtctaacaca ggcctggatt acatcaagtt tacttggaag
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart