pENTR- GFP- MDC1 (770- 7)

$193.00

  • Model: PVT10103
  • 50 Units in Stock
Ask a question


Add to Cart:

pENTR-GFP-MDC1 (770-7)


Catalog No. PVT10103
Packing 2ug
Function DNA Cloning plasmid
Resistance Kan
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pUC

Alias: MDC1, NFBD1, KIAA0170

Replicon: pUC ori

Plasmid size: 9539 BP

Plasmid label: N-EGFP

 

pENTR-GFP-MDC1 (770-7) Description

pENTR-GFP-MDC1 (770-7) is a plasmid carrying human MDC1 gene and fused with EGFP green fluorescent protein gene at N-terminal. The EGFP-MDC1 gene fragment can be transferred into other GateWay expression vectors by GateWay method.

 

pENTR-GFP-MDC1 (770-7) Sequence

LOCUS       Exported                9539 bp ds-DNA     circular SYN 26-OCT-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 9539)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..9539

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      103..189

                     /gene="Escherichia coli rrnB"

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      281..308

                     /label=rrnB T2 terminator

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     protein_bind    358..457

                     /gene="mutant version of attL"

                     /label=attL1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     regulatory      498..507

                     /regulatory_class="other"

                     /note="vertebrate consensus sequence for strong initiation 

                     of translation (Kozak, 1987)"

     CDS             504..1220

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTLTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITLGMDELYK"

     misc_feature    1257..7556

                     /label=MDC1

                     /note="Gene/Insert name Mediator of DNA damage checkpoint 1

                     Alt name MDC1

                     Alt name NFBD1

                     Alt name KIAA0170

                     Species H. sapiens (human)

                     Insert Size (bp) 6269

                     Entrez Gene MDC1 (a.k.a. NFBD1)

                     Tag / Fusion Protein

                     GFP (N terminal on backbone)"

     protein_bind    complement(7768..7867)

                     /gene="mutant version of attL"

                     /label=attL2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             7990..8799

                     /codon_start=1

                     /gene="aph(3')-Ia"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin in bacteria or G418 

                     (Geneticin(R)) in eukaryotes"

                     /translation="MSHIQRETSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYGKP

                     DAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPGDAWLLTTAIPGKTA

                     FQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDASD

                     FDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGIAD

                     RYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"

     rep_origin      8889..9477

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgctagca tggatctcgg

       61 ggacgtctaa ctactaagcg agagtaggga actgccaggc atcaaataaa acgaaaggct

      121 cagtcggaag actgggcctt tcgttttatc tgttgtttgt cggtgaacgc tctcctgagt

      181 aggacaaatc cgccgggagc ggatttgaac gttgtgaagc aacggcccgg agggtggcgg

      241 gcaggacgcc cgccataaac tgccaggcat caaactaagc agaaggccat cctgacggat

      301 ggcctttttg cgtttctaca aactcttcct gttagttagt tacttaagct cgggccccaa

      361 ataatgattt tattttgact gatagtgacc tgttcgttgc aacaaattga taagcaatgc

      421 ttttttataa tgccaacttt gtacaaaaaa gcaggctcca ccatgggaac caattcagtc

      481 gactagcgct accggtcgcc accatggtga gcaagggcga ggagctgttc accggggtgg

      541 tgcccatcct ggtcgagctg gacggcgacg taaacggcca caagttcagc gtgtccggcg

      601 agggcgaggg cgatgccacc tacggcaagc tgaccctgaa gttcatctgc accaccggca

      661 agctgcccgt gccctggccc accctcgtga ccaccctgac ctacggcgtg cagtgcttca

      721 gccgctaccc cgaccacatg aagcagcacg acttcttcaa gtccgccatg cccgaaggct

      781 acgtccagga gcgcaccatc ttcttcaagg acgacggcaa ctacaagacc cgcgccgagg

      841 tgaagttcga gggcgacacc ctggtgaacc gcatcgagct gaagggcatc gacttcaagg

      901 aggacggcaa catcctgggg cacaagctgg agtacaacta caacagccac aacgtctata

      961 tcatggccga caagcagaag aacggcatca aggtgaactt caagatccgc cacaacatcg

     1021 aggacggcag cgtgcagctc gccgaccact accagcagaa cacccccatc ggcgacggcc

     1081 ccgtgctgct gcccgacaac cactacctga gcacccagtc cgccctgagc aaagacccca

     1141 acgagaagcg cgatcacatg gtcctgctgg agttcgtgac cgccgccggg atcactctcg

     1201 gcatggacga gctgtacaag tccggccgga ctcagatctc gagctcaagc ttcgaattct

     1261 gcagtcgacg gtaccgcggg cccatcatgg aggacaccca ggctattgac tgggatgttg

     1321 aagaagagga ggagacagag caatccagtg aatccttgag gtgtaacgtg gagccagtag

     1381 ggcggctaca tatctttagt ggtgcccatg gaccagaaaa agatttccca ctacacctcg

     1441 ggaagaatgt ggtaggccga atgcctgact gctctgtggc cctgcccttt ccatctatct

     1501 ccaaacaaca tgcagagatt gaaatcttag cctgggacaa ggcacctatc ctccgagact

     1561 gtgggagcct taatggtact caaatcctga gacctcctaa ggttttgagc cctggggtga

     1621 gtcaccgtct gagggaccag gaattgattc tctttgctga cttgctctgc cagtaccatc

     1681 gcctggatgt ctctctgccc tttgtctccc ggggccctct gacagtagaa gagacaccca

     1741 gagtacaggg agaaactcaa ccccagaggc ttctgttggc tgaggactcg gaggaggaag

     1801 tagattttct ttctgaaagg cgtatggtaa aaaaatcaag gaccacatct tcctctgtga

     1861 tagttccaga gagtgatgaa gaggggcatt ccccggtcct gggcggcctt gggccgcctt

     1921 ttgccttcaa tttgaacagt gacacagatg tggaagaagg tcagcaacca gccacagagg

     1981 aggcctcctc agctgccaga agaggtgcca ctgtagaggc aaagcagtct gaagctgaag

     2041 ttgtaactga aatccagctt gaaaaggatc agcctttagt gaaggagagg gacaatgata

     2101 caaaagtcaa gaggggtgca gggaatgggg tggttccagc tggggtgatt ctggagagga

     2161 gccaacctcc tggagaggac agtgacacag atgtggatga tgacagcagg cctcctggaa

     2221 ggccagctga ggtccatttg gaaagggctc agccttttgg cttcatcgac agcgacactg

     2281 atgcggaaga agagaggatc ccagcaaccc cagttgtcat tcctatgaag aagaggaaga

     2341 tcttccatgg agtaggtaca aggggtcctg gagcaccagg cctggcccat ctgcaggaga

     2401 gccaggctgg tagtgataca gatgtggaag aaggcaaggc cccacaggct gtccctctgg

     2461 agaaaagcca agcttccatg gttatcaaca gcgatacaga tgacgaggaa gaagtctcag

     2521 cagcgctgac tttggcacat ctgaaagaga gccagcctgc tatatggaac agagatgcag

     2581 aagaggacat gccccaacgt gtggtccttc tgcagcgaag ccaaaccacc actgagagag

     2641 acagtgacac agacgtggag gaggaagagc tcccagtgga aaatagagaa gctgtcctca

     2701 aggatcacac aaagattaga gcccttgtta gagcacattc agaaaaggac caacctcctt

     2761 ttggggacag tgatgacagt gtggaagcag ataagagctc acctgggatc cacctggaga

     2821 gaagccaagc ctccaccaca gtggacatca acacacaagt ggagaaggaa gtcccgccag

     2881 ggtcagccat tatgcatata aagaagcatc aggtgtctgt ggaggggaca aatcaaacag

     2941 atgtgaaagc agttggggga ccagcaaagc tgcttgtggt atctctagag gaagcctggc

     3001 ctctgcatgg ggactgtgaa acagatgcag aggagggcac ctccctaaca gcctcagtag

     3061 ttgcagatgt aagaaagagc cagcttccag cagaagggga tgctggggca gagtgggctg

     3121 cagctgttct taagcaggag agagctcatg aggtgggggc ccagggtggg ccacctgtgg

     3181 cacaagtgga gcaggacctc cctatctcaa gagagaacct cacagatctg gtggtggaca

     3241 cagacactct aggggaatcc acccagccac agagagaggg agcccaggtc cccacaggaa

     3301 gggagagaga acaacatgtg ggtgggacca aggactctga agacaactat ggtgattctg

     3361 aagatctgga cctacaagct acccagtgct ttctggagaa tcagggcctg gaagcagtcc

     3421 agagcatgga ggatgaacct acccaggcct tcatgttgac tccaccccaa gagcttggcc

     3481 cttcccattg cagcttccag acaacaggta ccctagatga accatgggag gtcctggcta

     3541 cacagccatt ctgtctgaga gagtctgagg actctgagac ccagcctttt gacacgcacc

     3601 ttgaggccta tggaccttgc ctgtctccac ctagggcaat accaggagac caacatccag

     3661 agagcccagt tcacacagag ccaatgggga ttcaaggcag agggaggcag actgtggata

     3721 aagtcatggg tataccaaaa gaaacagcag agagggtggg ccctgagaga gggccattgg

     3781 agagagaaac tgagaaactg ctaccagaaa gacagacaga tgtgacagga gaggaagaat

     3841 taaccaaggg gaaacaggac agagaacaaa aacagttgtt agctagagac acccagagac

     3901 aagaatctga caaaaatggg gaaagtgcaa gtcctgaaag agatagggag agtttgaagg

     3961 tagaaattga gacatctgag gaaatacaag agaaacaagt acagaagcag acccttccaa

     4021 gcaaagcatt tgagagagaa gtagagagac cagtagcaaa cagagagtgc gatccagccg

     4081 agttagaaga gaaggtgccc aaagtgatcc tggagagaga tacacagaga ggggagccag

     4141 agggagggag ccaggaccag aaagggcagg cctccagccc aacaccagag cctggggtgg

     4201 gggcggggga ccttccggga cctacctcag cccccgtacc ttctgggagc cagtcaggtg

     4261 gaaggggatc cccagtgagc cccaggaggc atcagaaagg cctcctgaat tgcaagatgc

     4321 cacctgctga gaaggcttcc aggatcagag ctgctgagaa ggtttccagg ggcgatcagg

     4381 aatctccaga tgcttgtctg cctcctgcag tacctgaagc cccagcccca ccccaaaagc

     4441 cccttaactc tcagagccag aaacatcttg cacctccgcc ccttctttct ccccttttac

     4501 cttctatcaa gccaaccgtt cgtaagacca ggcaagatgg gagtcaggaa gctccagagg

     4561 ctcccttgtc ctcagagctg gagcctttcc acccaaagcc taaaattaga actcggaagt

     4621 cctccagaat gacacccttt ccagctacct ctgctgcccc tgagccccac ccttccacct

     4681 ccacagccca gccagtcact cccaagccca catctcaggc cactaggagc aggacaaata

     4741 ggtcctctgt caagacccct gaaccagttg tccccacagc ccctgagctc cagccttcca

     4801 cctccacaga ccagcctgtc acctctgagc ccacatctca ggttactagg ggaagaaaaa

     4861 gtagatcctc tgtcaagacc cctgaaacag ttgtgcccac agcccttgag ctccagcctt

     4921 ccacctccac cgaccgacct gtcacctctg aacccacctc tcaggctact aggggaagaa

     4981 aaaatagatc ctctgtcaag acccctgaac cagttgtccc cacagcccct gagctccagc

     5041 cttccacctc cacagaccag cctgtcactt ctgagcccac atatcaggct actaggggaa

     5101 gaaaaaatag atcctctgtc aagacccctg aaccagttgt gcccacagcc cctgagctcc

     5161 ggccttccac ctccacagac cgacctgtca cccccaagcc cacatctcgg accactagga

     5221 gcaggacaaa tatgtcctct gtcaagaccc ctgaaacagt tgtccccaca gcccctgagc

     5281 tccagatttc cacctccaca gaccaacctg tcacccctaa gcccacatct cggaccacta

     5341 ggagcaggac aaatatgtcc tctgtgaaga accctgaatc aactgtccct atagcccctg

     5401 agctcccacc ttccacctcc acagagcagc ctgtcacccc tgagcccaca tctcgggcta

     5461 ctaggggaag aaaaaataga tcctctggca agacccctga aacacttgtc cccacagccc

     5521 ctaagctcga gccttccact tccacagacc aacctgtcac tcctgagccc acatctcagg

     5581 ccaccagggg caggacaaat aggtcctctg tgaagacccc tgaaacagtt gtccccacag

     5641 cccctgagct ccagccttcc acctccacag accagcctgt tacccctgag cctacgtctc

     5701 aggctactag gggaagaaca gatagatcct ctgtcaagac tcctgaaaca gttgtcccca

     5761 cagcccctga gctacaggct tccgcctcca cagaccagcc tgtcacctct gagcccacat

     5821 ctcggaccac taggggaaga aaaaatcggt cctctgtcaa gacccctgaa acagttgtgc

     5881 ccgcagcccc tgagctccag cctcccacct ccacagaccg acctgtcacc cctgagccca

     5941 catctcgggc cactaggggc aggacaaata ggtcctctgt caagacccct gaatcaattg

     6001 tccctatagc ccctgagctt cagccttcca cctccagaaa ccagcttgtc acccctgagc

     6061 ccacatctcg ggccactagg tgcaggacaa ataggtcctc tgtcaagacc cctgagccag

     6121 ttgtccccac agcccctgag ccccatccta ccacctccac agaccagcct gtcaccccca

     6181 agctcacatc tagggccact aggagaaaga caaataggtc ctctgtcaag actcccaaac

     6241 cagttgaacc agcagcctct gatcttgagc cttttacccc cacagaccag tccgtcaccc

     6301 ctgaggccat agctcagggt ggtcagagca aaacactgag gtcttccaca gtaagagcta

     6361 tgccggttcc taccacccct gaattccaat ctcctgtcac cacagaccag cctatttccc

     6421 ctgagcctat tactcaaccc agttgcatca agaggcagag agccgctggg aaccctggct

     6481 ccctcgcagc tcccattgac cataagcctt gctctgcacc cttggaacct aaatcccagg

     6541 cctcaaggaa ccaaagatgg ggagcagtga gagcagctga atcccttaca gccattcctg

     6601 agcctgcctc tccccagctt cttgagacac caattcatgc ctcccagatc caaaaggtgg

     6661 aaccagcagg tagatctagg ttcaccccgg agctccagcc taaggcctct caaagccgca

     6721 agaggtcttt agctaccatg gattcaccac cacatcaaaa acagccccaa agaggggaag

     6781 tctcccagaa gacagtgatt atcaaggaag aggaagaaga tactgcagag aagccaggga

     6841 aggaagagga tgtcgtgact ccaaaaccag gcaagagaaa gagagaccag gcagaggagg

     6901 agcccaacag aataccaagc cgcagcctcc gacggaccaa acttaaccaa gaatcaacag

     6961 cccccaaagt gctcttcaca ggagtggtgg atgctcgggg agagcgggct gtgctggcac

     7021 tggggggaag tctggctggt tcagcggcag aggcttccca cctggtcact gatcgcatcc

     7081 gccggacagt caagttcctg tgtgccctgg ggcggggaat ccccattctg tccctggact

     7141 ggctgcatca gtcccgcaag gctggtttct tcttaccccc ggatgaatat gtggtgaccg

     7201 accctgagca agagaagaac tttggcttta gccttcaaga cgcactgagc agggctcggg

     7261 agcgaaggct gctagagggc tatgagatct atgtgacccc tggagtccag ccaccaccac

     7321 ctcagatggg agagattatt agctgctgtg gaggcacata cctacccagc atgcctcggt

     7381 cctataagcc tcagagagtt gtgatcacat gccctcagga cttccctcat tgctccattc

     7441 cactacgggt tgggctgccc ctcctctcgc ctgagttcct gctgactgga gtgctgaagc

     7501 aggaagccaa gccagaggcc tttgtcctct cccctttgga gatgtcatcc acctgagaac

     7561 tccactaccc ttttccctcc cagaccacga attagaagat atgtggaaga aagaactcag

     7621 ggcgttagaa aggattgggg tatattgata caacttgtcc tggaacatgg gtgggaccag

     7681 aaatctttat gaataaatga aaagataagg gatttggaag ccacaggttg ttttttgttt

     7741 gtttgtttgt ttttttaatg gatctagacc cagctttctt gtacaaagtt ggcattataa

     7801 gaaagcattg cttatcaatt tgttgcaacg aacaggtcac tatcagtcaa aataaaatca

     7861 ttatttgcca tccagctgca gctctggccc gtgtctcaaa atctctgatg ttacattgca

     7921 caagataaaa atatatcatc atgaacaata aaactgtctg cttacataaa cagtaataca

     7981 aggggtgtta tgagccatat tcaacgggaa acgtcgaggc cgcgattaaa ttccaacatg

     8041 gatgctgatt tatatgggta taaatgggct cgcgataatg tcgggcaatc aggtgcgaca

     8101 atctatcgct tgtatgggaa gcccgatgcg ccagagttgt ttctgaaaca tggcaaaggt

     8161 agcgttgcca atgatgttac agatgagatg gtcagactaa actggctgac ggaatttatg

     8221 cctcttccga ccatcaagca ttttatccgt actcctggtg atgcatggtt actcaccact

     8281 gcgatccccg gaaaaacagc attccaggta ttagaagaat atcctgattc aggtgaaaat

     8341 attgttgatg cgctggcagt gttcctgcgc cggttgcatt cgattcctgt ttgtaattgt

     8401 ccttttaaca gcgatcgcgt atttcgtctc gctcaggcgc aatcacgaat gaataacggt

     8461 ttggttgatg cgagtgattt tgatgacgag cgtaatggct ggcctgttga acaagtctgg

     8521 aaagaaatgc ataaactttt gccattctca ccggattcag tcgtcactca tggtgatttc

     8581 tcacttgata accttatttt tgacgagggg aaattaatag gttgtattga tgttggacga

     8641 gtcggaatcg cagaccgata ccaggatctt gccatcctat ggaactgcct cggtgagttt

     8701 tctccttcat tacagaaacg gctttttcaa aaatatggta ttgataatcc tgatatgaat

     8761 aaattgcagt ttcatttgat gctcgatgag tttttctaat cagaattggt taattggttg

     8821 taacattatt cagattgggc cccgttccac tgagcgtcag accccgtaga aaagatcaaa

     8881 ggatcttctt gagatccttt ttttctgcgc gtaatctgct gcttgcaaac aaaaaaacca

     8941 ccgctaccag cggtggtttg tttgccggat caagagctac caactctttt tccgaaggta

     9001 actggcttca gcagagcgca gataccaaat actgttcttc tagtgtagcc gtagttaggc

     9061 caccacttca agaactctgt agcaccgcct acatacctcg ctctgctaat cctgttacca

     9121 gtggctgctg ccagtggcga taagtcgtgt cttaccgggt tggactcaag acgatagtta

     9181 ccggataagg cgcagcggtc gggctgaacg gggggttcgt gcacacagcc cagcttggag

     9241 cgaacgacct acaccgaact gaga

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart