pENTR223- DPYD

$182.00

  • Model: PVT10065
  • 50 Units in Stock
Ask a question


Add to Cart:

pENTR223-DPYD

Catalog No. PVT10065
Packing 2ug

 

pENTR223-DPYD Information

Function DNA Cloning plasmid

Alias: NM_001160301.1, DHP; DHPDHASE; DPD

Prokaryotic resistance: splendin Spe

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

 

pENTR223-DPYD Description

Homo sapiens dihydropyrimidine dehydrogenase (DPYD), transcript variant 2, mRNA

 

pENTR223-DPYD Sequence

LOCUS       Exported                3309 bp ds-DNA     circular SYN 21-FEB-2018
FEATURES             Location/Qualifiers
     source          1..3309
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     357..373
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    389..487
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    488..1006
                     /label=DPYD
     protein_bind    complement(1008..1107)
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        complement(1125..1143)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1148..1164)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1595..2386
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy, 
                     1985)"
                     /label=Spe
                     /note="confers resistance to spectinomycin and 
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      2479..3067
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaata cgcgtaccgc
       61 tagccaggaa gagtttgtag aaacgcaaaa aggccatccg tcaggatggc cttctgctta
      121 gtttgatgcc tggcagttta tggcgggcgt cctgcccgcc accctccggg ccgttgcttc
      181 acaacgttca aatccgctcc cggcggattt gtcctactca ggagagcgtt caccgacaaa
      241 caacagataa aacgaaaggc ccagtcttcc gactgagcct ttcgttttat ttgatgcctg
      301 gcagttccct actctcgcgt taacgctagc atggatgttt tcccagtcac gacgttgtaa
      361 aacgacggcc agtcttaagc tcgggcccca aataatgatt ttattttgac tgatagtgac
      421 ctgttcgttg caacaaattg ataagcaatg cttttttata atgccaactt tgtacaaaaa
      481 agttggcatg gcccctgtgc tcagtaagga ctcggcggac atcgagagta tcctggcttt
      541 aaatcctcga acacaaactc atgcaactct gtgttccact tcggccaaga aattagacaa
      601 gaaacattgg aaaagaaatc ctgataagaa ctgctttaat tgtgagaagc tggagaataa
      661 ttttgatgac atcaagcaca cgactcttgg tgagcgagga gctctccgag aagcaatgag
      721 atgcctgaaa tgtgcagatg ccccgtgtca gaagagctgt ccaactaatc ttgatattaa
      781 atcattcatc acaagtattg caaacaagaa ctattatgga gctgctaaga tgatattttc
      841 tgacaaccca cttggtctga cttgtggaat ggtatgtcca acctctgatc tttgtgtagg
      901 tggatgcaat ttatatgcca ctgaagaggg acccattaat attggtggat tgcagcaatt
      961 tgctactgag actttgatcc tggctttctc tttaatgaat catttgtacc caactttctt
     1021 gtacaaagtt ggcattataa gaaagcattg cttatcaatt tgttgcaacg aacaggtcac
     1081 tatcagtcaa aataaaatca ttatttgcca tccagctgat atcccctata gtgagtcgta
     1141 ttacatggtc atagctgttt cctggcagct ctggcccgtg tctcaaaatc tctgatgtta
     1201 cattgcacaa gataaaaata tatcatcatg cctcctctag accagccagg acagaaatgc
     1261 ctcgacttcg ctgctgccca aggttgccgg gtgacgcaca ccgtggaaac ggatgaaggc
     1321 acgaacccag tggacataag cctgttcggt tcgtaagctg taatgcaagt agcgtatgcg
     1381 ctcacgcaac tggtccagaa ccttgaccga acgcagcggt ggtaacggcg cagtggcggt
     1441 tttcatggct tgttatgact gtttttttgg ggtacagtct atgcctcggg catccaagca
     1501 gcaagcgcgt tacgccgtgg gtcgatgttt gatgttatgg agcagcaacg atgttacgca
     1561 gcagggcagt cgccctaaaa caaagttaaa catcatgagg gaagcggtga tcgccgaagt
     1621 atcgactcaa ctatcagagg tagttggcgt catcgagcgc catctcgaac cgacgttgct
     1681 ggccgtacat ttgtacggct ccgcagtgga tggcggcctg aagccacaca gtgatattga
     1741 tttgctggtt acggtgaccg taaggcttga tgaaacaacg cggcgagctt tgatcaacga
     1801 ccttttggaa acttcggctt cccctggaga gagcgagatt ctccgcgctg tagaagtcac
     1861 cattgttgtg cacgacgaca tcattccgtg gcgttatcca gctaagcgcg aactgcaatt
     1921 tggagaatgg cagcgcaatg acattcttgc aggtatcttc gagccagcca cgatcgacat
     1981 tgatctggct atcttgctga caaaagcaag agaacatagc gttgccttgg taggtccagc
     2041 ggcggaggaa ctctttgatc cggttcctga acaggatcta tttgaggcgc taaatgaaac
     2101 cttaacgcta tggaactcgc cgcccgactg ggctggcgat gagcgaaatg tagtgcttac
     2161 gttgtcccgc atttggtaca gcgcagtaac cggcaaaatc gcgccgaagg atgtcgctgc
     2221 cgactgggca atggagcgcc tgccggccca gtatcagccc gtcatacttg aagctagaca
     2281 ggcttatctt ggacaagaag aagatcgctt ggcctcgcgc gcagatcagt tggaagaatt
     2341 tgtccactac gtgaaaggcg agatcaccaa ggtagtcggc aaataaccct cgagccaccc
     2401 atgaccaaaa tcccttaacg tgagttacgc gtcgttccac tgagcgtcag accccgtaga
     2461 aaagatcaaa ggatcttctt gagatccttt ttttctgcgc gtaatctgct gcttgcaaac
     2521 aaaaaaacca ccgctaccag cggtggtttg tttgccggat caagagctac caactctttt
     2581 tccgaaggta actggcttca gcagagcgca gataccaaat actgtccttc tagtgtagcc
     2641 gtagttaggc caccacttca agaactctgt agcaccgcct acatacctcg ctctgctaat
     2701 cctgttacca gtggctgctg ccagtggcga taagtcgtgt cttaccgggt tggactcaag
     2761 acgatagtta ccggataagg cgcagcggtc gggctgaacg gggggttcgt gcacacagcc
     2821 cagcttggag cgaacgacct acaccgaact gagataccta cagcgtgagc attgagaaag
     2881 cgccacgctt cccgaaggga gaaaggcgga caggtatccg gtaagcggca gggtcggaac
     2941 aggagagcgc acgagggagc ttccaggggg aaacgcctgg tatctttata gtcctgtcgg
     3001 gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc tcgtcagggg ggcggagcct
     3061 atggaaaaac gccagcaacg cggccttttt acggttcctg gccttttgct ggccttttgc
     3121 tcacatgttc tttcctgcgt tatcccctga ttctgtggat aaccgtatta ccgcctttga
     3181 gtgagctgat accgctcgcc gcagccgaac gaccgagcgc agcgagtcag tgagcgagga
     3241 agcggaagag cgcccaatac gcaaaccgcc tctccccgcg cgttggccga ttcattaatg
     3301 cagctggca
//
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart