pENTR223- PRDX1

$215.00

  • Model: PVT10049
  • 50 Units in Stock
Ask a question


Add to Cart:

pENTR223-PRDX1


Catalog No. PVT10049
Packing 2ug

 

pENTR223-PRDX1 Information


Function DNA Cloning plasmid

Alias: NM_002574.3, MSP23; NKEF-A; NKEFA; P

Prokaryotic resistance: splendin Spe

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

 

pENTR223-PRDX1 Description

PENTR223-PRDX1 is a human gene clone plasmid, Homo sapiens peroxiredoxin 1 (PRDX1), transcript variant 1, mRNA

 

pENTR223-PRDX1 Sequence

LOCUS       Exported                3387 bp ds-DNA     circular SYN 06-FEB-2018
FEATURES             Location/Qualifiers
     source          1..3387
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     primer_bind     357..373
                     /label=M13 fwd
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    389..487
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    488..1084
                     /label=PRDX1
     protein_bind    complement(1086..1185)
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     promoter        complement(1203..1221)
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     primer_bind     complement(1226..1242)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     CDS             1673..2464
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy, 
                     1985)"
                     /label=Spe
                     /note="confers resistance to spectinomycin and 
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      2557..3145
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaata cgcgtaccgc
       61 tagccaggaa gagtttgtag aaacgcaaaa aggccatccg tcaggatggc cttctgctta
      121 gtttgatgcc tggcagttta tggcgggcgt cctgcccgcc accctccggg ccgttgcttc
      181 acaacgttca aatccgctcc cggcggattt gtcctactca ggagagcgtt caccgacaaa
      241 caacagataa aacgaaaggc ccagtcttcc gactgagcct ttcgttttat ttgatgcctg
      301 gcagttccct actctcgcgt taacgctagc atggatgttt tcccagtcac gacgttgtaa
      361 aacgacggcc agtcttaagc tcgggcccca aataatgatt ttattttgac tgatagtgac
      421 ctgttcgttg caacaaattg ataagcaatg cttttttata atgccaactt tgtacaaaaa
      481 agttggcatg tcttcaggaa atgctaaaat tgggcaccct gcccccaact tcaaagccac
      541 agctgttatg ccagatggtc agtttaaaga tatcagcctg tctgactaca aaggaaaata
      601 tgttgtgttc ttcttttacc ctcttgactt cacctttgtg tgccccacgg agatcattgc
      661 tttcagtgat agggcagaag aatttaagaa actcaactgc caagtgattg gtgcttctgt
      721 ggattctcac ttctgtcatc tagcatgggt caatacacct aagaaacaag gaggactggg
      781 acccatgaac attcctttgg tatcagaccc gaagcgcacc attgctcagg attatggggt
      841 cttaaaggct gatgaaggca tctcgttcag gggccttttt atcattgatg ataagggtat
      901 tcttcggcag atcactgtaa atgacctccc tgttggccgc tctgtggatg agactttgag
      961 actagttcag gccttccagt tcactgacaa acatggggaa gtgtgcccag ctggctggaa
     1021 acctggcagt gataccatca agcctgatgt ccaaaagagc aaagaatatt tctccaagca
     1081 gaagtgccca actttcttgt acaaagttgg cattataaga aagcattgct tatcaatttg
     1141 ttgcaacgaa caggtcacta tcagtcaaaa taaaatcatt atttgccatc cagctgatat
     1201 cccctatagt gagtcgtatt acatggtcat agctgtttcc tggcagctct ggcccgtgtc
     1261 tcaaaatctc tgatgttaca ttgcacaaga taaaaatata tcatcatgcc tcctctagac
     1321 cagccaggac agaaatgcct cgacttcgct gctgcccaag gttgccgggt gacgcacacc
     1381 gtggaaacgg atgaaggcac gaacccagtg gacataagcc tgttcggttc gtaagctgta
     1441 atgcaagtag cgtatgcgct cacgcaactg gtccagaacc ttgaccgaac gcagcggtgg
     1501 taacggcgca gtggcggttt tcatggcttg ttatgactgt ttttttgggg tacagtctat
     1561 gcctcgggca tccaagcagc aagcgcgtta cgccgtgggt cgatgtttga tgttatggag
     1621 cagcaacgat gttacgcagc agggcagtcg ccctaaaaca aagttaaaca tcatgaggga
     1681 agcggtgatc gccgaagtat cgactcaact atcagaggta gttggcgtca tcgagcgcca
     1741 tctcgaaccg acgttgctgg ccgtacattt gtacggctcc gcagtggatg gcggcctgaa
     1801 gccacacagt gatattgatt tgctggttac ggtgaccgta aggcttgatg aaacaacgcg
     1861 gcgagctttg atcaacgacc ttttggaaac ttcggcttcc cctggagaga gcgagattct
     1921 ccgcgctgta gaagtcacca ttgttgtgca cgacgacatc attccgtggc gttatccagc
     1981 taagcgcgaa ctgcaatttg gagaatggca gcgcaatgac attcttgcag gtatcttcga
     2041 gccagccacg atcgacattg atctggctat cttgctgaca aaagcaagag aacatagcgt
     2101 tgccttggta ggtccagcgg cggaggaact ctttgatccg gttcctgaac aggatctatt
     2161 tgaggcgcta aatgaaacct taacgctatg gaactcgccg cccgactggg ctggcgatga
     2221 gcgaaatgta gtgcttacgt tgtcccgcat ttggtacagc gcagtaaccg gcaaaatcgc
     2281 gccgaaggat gtcgctgccg actgggcaat ggagcgcctg ccggcccagt atcagcccgt
     2341 catacttgaa gctagacagg cttatcttgg acaagaagaa gatcgcttgg cctcgcgcgc
     2401 agatcagttg gaagaatttg tccactacgt gaaaggcgag atcaccaagg tagtcggcaa
     2461 ataaccctcg agccacccat gaccaaaatc ccttaacgtg agttacgcgt cgttccactg
     2521 agcgtcagac cccgtagaaa agatcaaagg atcttcttga gatccttttt ttctgcgcgt
     2581 aatctgctgc ttgcaaacaa aaaaaccacc gctaccagcg gtggtttgtt tgccggatca
     2641 agagctacca actctttttc cgaaggtaac tggcttcagc agagcgcaga taccaaatac
     2701 tgtccttcta gtgtagccgt agttaggcca ccacttcaag aactctgtag caccgcctac
     2761 atacctcgct ctgctaatcc tgttaccagt ggctgctgcc agtggcgata agtcgtgtct
     2821 taccgggttg gactcaagac gatagttacc ggataaggcg cagcggtcgg gctgaacggg
     2881 gggttcgtgc acacagccca gcttggagcg aacgacctac accgaactga gatacctaca
     2941 gcgtgagcat tgagaaagcg ccacgcttcc cgaagggaga aaggcggaca ggtatccggt
     3001 aagcggcagg gtcggaacag gagagcgcac gagggagctt ccagggggaa acgcctggta
     3061 tctttatagt cctgtcgggt ttcgccacct ctgacttgag cgtcgatttt tgtgatgctc
     3121 gtcagggggg cggagcctat ggaaaaacgc cagcaacgcg gcctttttac ggttcctggc
     3181 cttttgctgg ccttttgctc acatgttctt tcctgcgtta tcccctgatt ctgtggataa
     3241 ccgtattacc gcctttgagt gagctgatac cgctcgccgc agccgaacga ccgagcgcag
     3301 cgagtcagtg agcgaggaag cggaagagcg cccaatacgc aaaccgcctc tccccgcgcg
     3361 ttggccgatt cattaatgca gctggca
//
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart