pENTR223- STXBP1

$160.00

  • Model: PVT10000
  • 50 Units in Stock
Ask a question


Add to Cart:

pENTR223-STXBP1


Catalog No. PVT10000
Packing 2ug
Function DNA Cloning plasmid
Resistance Spe
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pBR322
Copy Middle
Promoter -
Induction -
Forward primer M13F
Reverse primer M13R

 

pENTR223-STXBP1 Sequence

LOCUS       Exported                4574 bp ds-DNA     circular SYN 05-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..4574
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     terminator      268..295
                     /label=rrnB T2 terminator
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      387..473
                     /gene="Escherichia coli rrnB"
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     protein_bind    570..668
                     /gene="mutant version of attL"
                     /label=attL1
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     misc_feature    669..2451
                     /label=STXBP1
                     /note="NM_001032221.3"
     protein_bind    complement(2452..2551)
                     /gene="mutant version of attL"
                     /label=attL2
                     /bound_moiety="LR Clonase(TM)"
                     /note="recombination site for the Gateway(R) LR reaction"
     CDS             3040..3831
                     /codon_start=1
                     /gene="aadA"
                     /product="aminoglycoside adenylyltransferase (Murphy, 
                     1985)"
                     /label=Spe
                     /note="confers resistance to spectinomycin and 
                     streptomycin"
                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH
                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK
                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF
                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP
                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"
     rep_origin      3924..4512
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgcctttg agtgagctga
       61 taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga
      121 gcgcccaata cgcaaaccgc ctctccccgc gcgttggccg attcattaat gcagctggca
      181 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaata cgcgtaccgc
      241 tagccaggaa gagtttgtag aaacgcaaaa aggccatccg tcaggatggc cttctgctta
      301 gtttgatgcc tggcagttta tggcgggcgt cctgcccgcc accctccggg ccgttgcttc
      361 acaacgttca aatccgctcc cggcggattt gtcctactca ggagagcgtt caccgacaaa
      421 caacagataa aacgaaaggc ccagtcttcc gactgagcct ttcgttttat ttgatgcctg
      481 gcagttccct actctcgcgt taacgctagc atggatgttt tcccagtcac gacgttgtaa
      541 aacgacggcc agtcttaagc tcgggccccc aaataatgat tttattttga ctgatagtga
      601 cctgttcgtt gcaacaaatt gatgagcaat gcttttttat aatgccaact ttgtacaaaa
      661 aagttggcat ggcccccatt ggcctcaaag ctgttgtcgg agagaagatt atgcatgatg
      721 tgataaagaa ggtcaagaag aagggggaat ggaaggtgct ggtggtggat cagttaagca
      781 tgaggatgct gtcctcctgc tgcaagatga cagacatcat gaccgagggc ataacgattg
      841 tggaagatat caataagcgc agagagccgc tccccagcct ggaggctgtg tatctcatca
      901 ctccatccga gaagtccgtc cactctctca tcagtgactt taaggacccg ccgactgcta
      961 aataccgggc tgcacacgtc ttcttcactg actcttgtcc agatgccctg tttaatgaac
     1021 tggtaaaatc ccgagcagcc aaagtcatca aaactctgac ggaaatcaat attgcatttc
     1081 tcccgtatga atcccaggtc tattccttgg actctgctga ctctttccaa agcttctaca
     1141 gtccccacaa ggctcagatg aagaatccta tactggagcg cctggcagag cagatcgcga
     1201 ccctttgtgc caccctgaag gagtacccgg ctgtgcggta tcggggggaa tacaaggaca
     1261 atgccctgct ggctcagcta atccaggaca agctcgatgc ctataaagct gatgatccaa
     1321 caatggggga gggcccagac aaggcacgct cccagctcct gatcctggat cgaggctttg
     1381 accccagctc ccctgtgctc catgaattga cttttcaggc tatgagttat gatctgctgc
     1441 ctatcgaaaa tgatgtatac aagtatgaga ccagcggcat cggggaggca cgggtgaagg
     1501 aggtgctcct ggacgaggac gacgacctgt ggatagcact gcgccacaag cacatcgcag
     1561 aggtgtccca ggaagtcacc cggtctctga aagatttttc ttctagcaag agaatgaata
     1621 ctggagagaa gaccaccatg cgggacctgt cccagatgct gaagaagatg cctcagtacc
     1681 agaaagagct cagcaagtac tccacccacc tgcaccttgc tgaggactgt atgaagcatt
     1741 accaaggcac cgtagacaaa ctctgccgag tggagcagga cctggccatg ggcacagatg
     1801 ctgagggaga gaagatcaag gaccctatgc gagccatcgt ccccattctg ctggatgcca
     1861 atgtcagcac ttatgacaaa atccgcatca tccttctcta catctttttg aagaatggca
     1921 tcacggagga aaacctgaac aaactgatcc agcacgccca gatacccccg gaggatagtg
     1981 agatcatcac caacatggct cacctcggcg tgcccatcgt caccgattcc acgctgcgtc
     2041 gccggagcaa gccggagcgg aaggaacgca tcagcgagca gacctaccag ctctcacggt
     2101 ggactccgat tatcaaggac atcatggagg acactattga ggacaaactt gacaccaaac
     2161 actaccctta tatctctacc cgttcctctg cctccttcag caccaccgcc gtcagcgccc
     2221 gctatgggca ctggcataag aacaaggccc caggcgagta ccgcagtggc ccccgcctca
     2281 tcattttcat ccttgggggt gtgagcctga atgagatgcg ctgcgcctac gaggtgaccc
     2341 aggccaacgg aaagtgggag gtgctgatag gatccacaca catcctcacc ccacagaaac
     2401 tgctggacac actgaagaaa ctgaataaaa cagatgaaga aataagcagt tacccaactt
     2461 tcttgtacaa agttggcatt ataagaaagc attgcttatc aatttgttgc aacgaacagg
     2521 tcactatcag tcaaaataaa atcattattt ggccatccag ctgatatccc ctatagtgag
     2581 tcgtattaca tggtcatagc tgtttcctgg cagctctggc ccgtgtctca aaatctctga
     2641 tgttacattg cacaagataa aaatatatca tcatgcctcc tctagaccag ccaggacaga
     2701 aatgcctcga cttcgctgct gcccaaggtt gccgggtgac gcacaccgtg gaaacggatg
     2761 aaggcacgaa cccagtggac ataagcctgt tcggttcgta agctgtaatg caagtagcgt
     2821 atgcgctcac gcaactggtc cagaaccttg accgaacgca gcggtggtaa cggcgcagtg
     2881 gcggttttca tggcttgtta tgactgtttt tttggggtac agtctatgcc tcgggcatcc
     2941 aagcagcaag cgcgttacgc cgtgggtcga tgtttgatgt tatggagcag caacgatgtt
     3001 acgcagcagg gcagtcgccc taaaacaaag ttaaacatca tgagggaagc ggtgatcgcc
     3061 gaagtatcga ctcaactatc agaggtagtt ggcgtcatcg agcgccatct cgaaccgacg
     3121 ttgctggccg tacatttgta cggctccgca gtggatggcg gcctgaagcc acacagtgat
     3181 attgatttgc tggttacggt gaccgtaagg cttgatgaaa caacgcggcg agctttgatc
     3241 aacgaccttt tggaaacttc ggcttcccct ggagagagcg agattctccg cgctgtagaa
     3301 gtcaccattg ttgtgcacga cgacatcatt ccgtggcgtt atccagctaa gcgcgaactg
     3361 caatttggag aatggcagcg caatgacatt cttgcaggta tcttcgagcc agccacgatc
     3421 gacattgatc tggctatctt gctgacaaaa gcaagagaac atagcgttgc cttggtaggt
     3481 ccagcggcgg aggaactctt tgatccggtt cctgaacagg atctatttga ggcgctaaat
     3541 gaaaccttaa cgctatggaa ctcgccgccc gactgggctg gcgatgagcg aaatgtagtg
     3601 cttacgttgt cccgcatttg gtacagcgca gtaaccggca aaatcgcgcc gaaggatgtc
     3661 gctgccgact gggcaatgga gcgcctgccg gcccagtatc agcccgtcat actt
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart