pENTR223- TIGIT

$160.00

  • Model: PVT10003
  • 50 Units in Stock
Ask a question


Add to Cart:

pENTR223-TIGIT


Catalog No. PVT10003
Packing 2ug

 

pENTR223-TIGIT Information
Function DNA Cloning plasmid
Resistance Spe
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon pBR322
Copy Middle
Promoter -
Induction -
Forward primer M13F
Reverse primer M13R
Alternative name: NM_173799.3,VSIG9; VSTM3; WUCAM

 

pENTR223-TIGIT Sequence
 

LOCUS       Exported                3525 bp ds-DNA     circular SYN 05-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..3525

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      268..295

                     /label=rrnB T2 terminator

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     terminator      387..473

                     /gene="Escherichia coli rrnB"

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     protein_bind    569..668

                     /gene="mutant version of attL"

                     /label=attL1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     misc_feature    671..1402

                     /label=TIGIT

                     /note="NM_173799.3"

     protein_bind    complement(1404..1503)

                     /gene="mutant version of attL"

                     /label=attL2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             1991..2782

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /label=Spe

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MREAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"

     rep_origin      2875..3463

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgcctttg agtgagctga

       61 taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga

      121 gcgcccaata cgcaaaccgc ctctccccgc gcgttggccg attcattaat gcagctggca

      181 cgacaggttt cccgactgga aagcgggcag tgagcgcaac gcaattaata cgcgtaccgc

      241 tagccaggaa gagtttgtag aaacgcaaaa aggccatccg tcaggatggc cttctgctta

      301 gtttgatgcc tggcagttta tggcgggcgt cctgcccgcc accctccggg ccgttgcttc

      361 acaacgttca aatccgctcc cggcggattt gtcctactca ggagagcgtt caccgacaaa

      421 caacagataa aacgaaaggc ccagtcttcc gactgagcct ttcgttttat ttgatgcctg

      481 gcagttccct actctcgcgt taacgctagc atggatgttt tcccagtcac gacgttgtaa

      541 aacgacggcc agtcttaagc tcgggcccca aataatgatt ttattttgac tgatagtgac

      601 ctgttcgttg caacaaattg atgagcaatg cttttttata atgccaactt tgtacaaaaa

      661 agttggcacc atgcgctggt gtctcctcct gatctgggcc caggggctga ggcaggctcc

      721 cctcgcctca ggaatgatga caggcacaat agaaacaacg gggaacattt ctgcagagaa

      781 aggtggctct atcatcttac aatgtcacct ctcctccacc acggcacaag tgacccaggt

      841 caactgggag cagcaggacc agcttctggc catttgtaat gctgacttgg ggtggcacat

      901 ctccccatcc ttcaaggatc gagtggcccc aggtcccggc ctgggcctca ccctccagtc

      961 gctgaccgtg aacgatacag gggagtactt ctgcatctat cacacctacc ctgatgggac

     1021 gtacactggg agaatcttcc tggaggtcct agaaagctca gtggctgagc acggtgccag

     1081 gttccagatt ccattgcttg gagccatggc cgcgacgctg gtggtcatct gcacagcagt

     1141 catcgtggtg gtcgcgttga ctagaaagaa gaaagccctc agaatccatt ctgtggaagg

     1201 tgacctcagg agaaaatcag ctggacagga ggaatggagc cccagtgctc cctcaccccc

     1261 aggaagctgt gtccaggcag aagctgcacc tgctgggctc tgtggagagc agcggggaga

     1321 ggactgtgcc gagctgcatg actacttcaa tgtcctgagt tacagaagcc tgggtaactg

     1381 cagcttcttc acagagactg gtttgccaac tttcttgtac aaagttggca ttataagaaa

     1441 gcattgctta tcaatttgtt gcaacgaaca ggtcactatc agtcaaaata aaatcattat

     1501 ttgccatcca gctgatatcc cctatagtga gtcgtattac atggtcatag ctgtttcctg

     1561 gcagctctgg cccgtgtctc aaaatctctg atgttacatt gcacaagata aaaatatatc

     1621 atcatgcctc ctctagacca gccaggacag aaatgcctcg acttcgctgc tgcccaaggt

     1681 tgccgggtga cgcacaccgt ggaaacggat gaaggcacga acccagtgga cataagcctg

     1741 ttcggttcgt aagctgtaat gcaagtagcg tatgcgctca cgcaactggt ccagaacctt

     1801 gaccgaacgc agcggtggta acggcgcagt ggcggttttc atggcttgtt atgactgttt

     1861 ttttggggta cagtctatgc ctcgggcatc caagcagcaa gcgcgttacg ccgtgggtcg

     1921 atgtttgatg ttatggagca gcaacgatgt tacgcagcag ggcagtcgcc ctaaaacaaa

     1981 gttaaacatc atgagggaag cggtgatcgc cgaagtatcg actcaactat cagaggtagt

     2041 tggcgtcatc gagcgccatc tcgaaccgac gttgctggcc gtacatttgt acggctccgc

     2101 agtggatggc ggcctgaagc cacacagtga tattgatttg ctggttacgg tgaccgtaag

     2161 gcttgatgaa acaacgcggc gagctttgat caacgacctt ttggaaactt cggcttcccc

     2221 tggagagagc gagattctcc gcgctgtaga agtcaccatt gttgtgcacg acgacatcat

     2281 tccgtggcgt tatccagcta agcgcgaact gcaatttgga gaatggcagc gcaatgacat

     2341 tcttgcaggt atcttcgagc cagccacgat cgacattgat ctggctatct tgctgacaaa

     2401 agcaagagaa catagcgttg ccttggtagg tccagcggcg gaggaactct ttgatccggt

     2461 tcctgaacag gatctatttg aggcgctaaa tgaaacctta acgctatgga actcgccgcc

     2521 cgactgggct ggcgatgagc gaaatgtagt gcttacgttg tcccgcattt ggtacagcgc

     2581 agtaaccggc aaaatcgcgc cgaaggatgt cgctgccgac tgggcaatgg agcgcctgcc

     2641 ggcccagtat cagcccgtca tacttgaagc tagacaggct tatcttggac aagaagaaga

     2701 tcgcttggcc tcgcgcgcag atcagttgga agaatttgtc cactacgtga aaggcgagat

     2761 caccaaggta gtcggcaaat aaccctcgag ccacccatga ccaaaatccc ttaacgtgag

     2821 ttacgcgtcg ttccactgag cgtcagaccc cgtagaaaag atcaaaggat cttcttgaga

     2881 tccttttttt ctgcgcgtaa tctgctgctt gcaaacaaaa aaaccaccgc taccagcggt

     2941 ggtttgtttg ccggatcaag agctaccaac tctttttccg aaggtaactg gcttcagcag

     3001 agcgcagata ccaaatactg tccttctagt gtagccgtag ttaggccacc acttcaagaa

     3061 ctctgtagca ccgcctacat acctcgctct gctaatcctg ttaccagtgg ctgctgccag

     3121 tggcgataag tcgtgtctta ccgggttgga ctcaagacga tagttaccgg ataaggcgca

     3181 gcggtcgggc tgaacggggg gttcgtgcac acagcccagc ttggagcgaa cgacctacac

     3241 cgaactgaga tacctacagc gtgagcattg agaaagcgcc acgcttcccg aagggagaaa

     3301 ggcggacagg tatccggtaa gcggcagggt cggaacagga gagcgcacga gggagcttcc

     3361 agggggaaac gcctggtatc tttatagtcc tgtcgggttt cgccacctct gacttgagcg

     3421 tcgatttttg tgatgctcgt caggggggcg gagcctatgg aaaaacgcca gcaacgcggc

     3481 ctttttacgg ttcctggcct tttgctggcc ttttgctcac atgtt

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart