pER8 Plasmid

$216.00

  • Model: PVT3024
  • 50 Units in Stock
Ask a question


Add to Cart:

pER8

PVT3024   2ug
 

Search name

pER8,Plasmid pER8,pER8 vector

 

pER8 Plasmid Information

Promoter: CaMV 35S
Replicon: ori
Terminator: NOS
Plasmid classification: plant series, protein overexpression vector
Plasmid size: 11522bp
Prokaryotic resistance: Spe
Selection marker: HygR
Clone strain: DH5 alpha
Culture conditions: 37 LB, aerobic
Expressing host: plant cell
Primers for 5'sequencing: M13F:TGTAAAACGACGGCCAGT
Primers for 3'sequencing: primers were designed according to the sequence
Use: Plant expression

pER8-plasmid

pER8 Plasmid Sequence

LOCUS       Exported               11517 bp ds-DNA     circular SYN 28-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..11517

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    1..25

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        216..262

                     /label=minimal CaMV 35S promoter

                     /note="minimal 35S promoter from cauliflower mosaic virus"

     CDS             291..542

                     /codon_start=1

                     /gene="lexA (truncated)"

                     /product="DNA-binding domain of E. coli LexA"

                     /label=LexA BD

                     /note="binds the 16-bp palindromic sequence 

                     5'-CTGTATATATATACAG-3'"

                     /translation="MKALTARQQEVFDLIRDHISQTGMPPTRAEIAQRLGFRSPNAAEE

                     HLKALARKGVIEIVSGASRGIRLLQEEEEGLPLVGRVAA"

     CDS             558..791

                     /codon_start=1

                     /gene="UL48"

                     /product="transcriptional activation domain of herpes 

                     simplex virus protein VP16 (Triezenberg et al., 1988; 

                     Cousens et al., 1989)"

                     /label=VP16 AD

                     /translation="APPTDVSLGDELHLDGEDVAMAHADALDDFDLDMLGDGDSPGPGF

                     TPHDSAPYGALDMADFEFEQMFTDALGIDEYGG"

     CDS             849..1742

                     /codon_start=1

                     /gene="ESR1"

                     /product="estrogen nuclear receptor alpha ligand-binding 

                     domain"

                     /label=ER-LBD

                     /translation="KRSKKNSLALSLTADQMVSALLDAEPPILYSEYDPTRPFSEASMM

                     GLLTNLADRELVHMINWAKRVPGFVDLTLHDQVHLLECAWLEILMIGLVWRSMEHPVKL

                     LFAPNLLLDRNQGKCVEGMVEIFDMLLATSSRFRMMNLQGEEFVCLKSIILLNSGVYTF

                     LSSTLKSLEEKDHIHRVLDKITDTLIHLMAKAGLTLQQQHQRLAQLLLILSHIRHMSNK

                     GMEHLYSMKCKNVVPLYDLLLEMLDAHRLHAPTSRGGASVEETDQSHLATAGSTSSHSL

                     QKYYITGEAEGFPATV"

     promoter        2294..2510

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     CDS             2525..3550

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     E"

     terminator      3552..3804

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     promoter        4127..4173

                     /label=minimal CaMV 35S promoter

                     /note="minimal 35S promoter from cauliflower mosaic virus"

     misc_feature    4199..4237

                     /label=MCS

     misc_feature    4983..5007

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             5535..6326

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /label=Spe

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"

     rep_origin      6570..7158

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    7344..7484

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      7828..8022

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     CDS             complement(8088..9155)

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     CDS             complement(9589..10218)

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

ORIGIN

        1 gtttacccgc caatatatcc tgtcaaacac tgatagttta aactgaaggc gggaaacgac

       61 aatctgatcc aagctcaagc taagcttgca tgcctgcagg atatcgtgga tccaagcttg

      121 ccacgtgccg ccacgtgccg ccacgtgccg ccacgtgcct ctagaggatc catctccact

      181 gacgtaaggg atgacgcaca atcccactat ccttcgcaag acccttcctc tatataagga

      241 agttcatttc atttggagag gacacgctgg gatccccaat tccgggcgga atgaaagcgt

      301 taacggccag gcaacaagag gtgtttgatc tcatccgtga tcacatcagc cagacaggta

      361 tgccgccgac gcgtgcggaa atcgcgcagc gtttggggtt ccgttcccca aacgcggctg

      421 aagaacatct gaaggcgctg gcacgcaaag gcgttattga aattgtttcc ggcgcatcac

      481 gcgggattcg tctgttgcag gaagaggaag aagggttgcc gctggtaggt cgtgtggctg

      541 ccggtgaacc gtcgagcgcc cccccgaccg atgtcagcct gggggacgag ctccacttag

      601 acggcgagga cgtggcgatg gcgcatgccg acgcgctaga cgatttcgat ctggacatgt

      661 tgggggacgg ggattccccg ggtccgggat ttacccccca cgactccgcc ccctacggcg

      721 ctctggatat ggccgacttc gagtttgagc agatgtttac cgatgccctt ggaattgacg

      781 agtacggtgg ggatccgtct gctggagaca tgagagctgc caacctttgg ccaagcccgc

      841 tcatgatcaa acgctctaag aagaacagcc tggccttgtc cctgacggcc gaccagatgg

      901 tcagtgcctt gttggatgct gagcccccca tactctattc cgagtatgat cctaccagac

      961 ccttcagtga agcttcgatg atgggcttac tgaccaacct ggcagacagg gagctggttc

     1021 acatgatcaa ctgggcgaag agggtgccag gctttgtgga tttgaccctc catgatcagg

     1081 tccaccttct agaatgtgcc tggctagaga tcctgatgat tggtctcgtc tggcgctcca

     1141 tggagcaccc agtgaagcta ctgtttgctc ctaacttgct cttggacagg aaccagggaa

     1201 aatgtgtaga gggcatggtg gagatcttcg acatgctgct ggctacatca tctcggttcc

     1261 gcatgatgaa tctgcaggga gaggagtttg tgtgcctcaa atctattatt ttgcttaatt

     1321 ctggagtgta cacatttctg tccagcaccc tgaagtctct ggaagagaag gaccatatcc

     1381 accgagtcct ggacaagatc acagacactt tgatccacct gatggccaag gcaggcctga

     1441 ccctgcagca gcagcaccag cggctggccc agctcctcct catcctctcc cacatcaggc

     1501 acatgagtaa caaaggcatg gagcatctgt acagcatgaa gtgcaagaac gtggtgcccc

     1561 tctatgacct gctgctggag atgctggacg cccaccgcct acatgcgccc actagccgtg

     1621 gaggggcatc cgtggaggag acggaccaaa gccacttggc cactgcgggc tctacttcat

     1681 cgcattcctt gcaaaagtat tacatcacgg gggaggcaga gggtttccct gccacagtct

     1741 gagagctccc tggcgaattc ccagagatgt tagctgaaat catcactaat cagataccaa

     1801 aatattcaaa tggaaatatc aaaaagcttc tgtttcatca aaaatgactc gacctaactg

     1861 agtaagctag cttgttcgag tattatggca ttgggaaaac tgtttttctt gtaccatttg

     1921 ttgtgcttgt aatttactgt gttttttatt cggttttcgc tatcgaactg tgaaatggaa

     1981 atggatggag aagagttaat gaatgatatg gtccttttgt tcattctcaa attaatatta

     2041 tttgtttttt ctcttatttg ttgtgtgttg aatttgaaat tataagagat atgcaaacat

     2101 tttgttttga gtaaaaatgt gtcaaatcgt ggcctctaat gaccgaagtt aatatgagga

     2161 gtaaaacatc ccaaacaagc ttggaaactg aaggcgggaa acgacaatct gatcatgagc

     2221 ggagaattaa gggagtcacg ttatgacccc cgccgatgac gcgggacaag ccgttttacg

     2281 tttggaactg acagaaccgc aacgattgaa ggagccactc agccgcgggt ttctggagtt

     2341 taatgagcta agcacatacg tcagaaacca ttattgcgcg ttcaaaagtc gcctaaggtc

     2401 actatcagct agcaaatatt tcttgtcaaa aatgctccac tgacgttcca taaattcccc

     2461 tcggtatcca attagagtct catattcact ctcaatccaa ataatctgca ccggatcccc

     2521 tagaatgaaa aagcctgaac tcaccgcgac gtctgtcgag aagtttctga tcgaaaagtt

     2581 cgacagcgtc tccgacctga tgcagctctc ggagggcgaa gaatctcgtg ctttcagctt

     2641 cgatgtagga gggcgtggat atgtcctgcg ggtaaatagc tgcgccgatg gtttctacaa

     2701 agatcgttat gtttatcggc actttgcatc ggccgcgctc ccgattccgg aagtgcttga

     2761 cattggggaa ttcagcgaga gcctgaccta ttgcatctcc cgccgtgcac agggtgtcac

     2821 gttgcaagac ctgcctgaaa ccgaactgcc cgctgttctg cagccggtcg cggaggccat

     2881 ggatgcgatc gctgcggccg atcttagcca gacgagcggg ttcggcccat tcggaccgca

     2941 aggaatcggt caatacacta catggcgtga tttcatatgc gcgattgctg atccccatgt

     3001 gtatcactgg caaactgtga tggacgacac cgtcagtgcg tccgtcgcgc aggctctcga

     3061 tgagctgatg ctttgggccg aggactgccc cgaagtccgg cacctcgtgc acgcggattt

     3121 cggctccaac aatgtcctga cggacaatgg ccgcataaca gcggtcattg actggagcga

     3181 ggcgatgttc ggggattccc aatacgaggt cgccaacatc ttcttctgga ggccgtggtt

     3241 ggcttgtatg gagcagcaga cgcgctactt cgagcggagg catccggagc ttgcaggatc

     3301 gccgcggctc cgggcgtata tgctccgcat tggtcttgac caactctatc agagcttggt

     3361 tgacggcaat ttcgatgatg cagcttgggc gcagggtcga tgcgacgcaa tcgtccgatc

     3421 cggagccggg actgtcgggc gtacacaaat cgcccgcaga agcgcggccg tctggaccga

     3481 tggctgtgta gaagtactcg ccgatagtgg aaaccgacgc cccagcactc gtccgagggc

     3541 aaaggaatag cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg

     3601 ccggtcttgc gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta

     3661 acatgtaatg catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat

     3721 acatttaata cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg

     3781 cggtgtcatc tatgttacta gatcggggaa ttgatccccc ctcgacagct tgcatgccag

     3841 cttgggctgc aggtcgaggc taaaaaacta atcgcattat catcccctcg acgtactgta

     3901 catataacca ctggttttat atacagcagt actgtacata taaccactgg ttttatatac

     3961 agcagtcgac gtactgtaca tataaccact ggttttatat acagcagtac tgtacatata

     4021 accactggtt ttatatacag cagtcgaggt aagattagat atggatatgt atatggatat

     4081 gtatatggtg gtaatgccat gtaatatgct cgactctagg atcttcgcaa gacccttcct

     4141 ctatataagg aagttcattt catttggaga ggacacgctg aagctagtcg actctagcct

     4201 cgaggcgcgc cgggcccata cgcgttaatt aactagtcga tccaggcctc ccagctttcg

     4261 tccgtatcat cggtttcgac aacgttcgtc aagttcaatg catcagtttc attgcccaca

     4321 caccagaatc ctactaagtt tgagtattat ggcattggaa aagctgtttt cttctatcat

     4381 ttgttctgct tgtaatttac tgtgttcttt cagtttttgt tttcggacat caaaatgcaa

     4441 atggatggat aagagttaat aaatgatatg gtccttttgt tcattctcaa attattatta

     4501 tctgttgttt ttactttaat gggttgaatt taagtaagaa aggaactaac agtgtgatat

     4561 taaggtgcaa tgttagacat ataaaacagt ctttcacctc tctttggtta tgtcttgaat

     4621 tggtttgttt cttcacttat ctgtgtaatc aagtttacta tgagtctatg atcaagtaat

     4681 tatgcaatca agttaagtac agtataggct ttttgtgtcg agggggtacc gagtcgagga

     4741 attcactggc cgtcgtttta caacgtcgtg actgggaaaa ccctggcgtt acccaactta

     4801 atcgccttgc agcacatccc cctttcgcca gctggcgtaa tagcgaagag gcccgcaccg

     4861 atcgcccttc ccaacagttg cgcagcctga atggcgggta ccgagctcga attcaattcg

     4921 gcgttaattc agtacattaa aaacgtccgc aatgtgttat taagttgtct aagcgtcaat

     4981 ttgtttacac cacaatatat cctgccacca gccagccaac agctccccga ccggcagctc

     5041 ggcacaaaat caccactcga tacaggcagc ccatcagtcc gggacggcgt cagcgggaga

     5101 gccgttgtaa ggcggcagac tttgctcatg ttaccgatgc tattcggaag aacggcaact

     5161 aagctgccgg gtttgaaaca cggatgatct cgcggagggt agcatgttga ttgtaacgat

     5221 gacagagcgt tgctgcctgt gatcaattcg ggcacgaacc cagtggacat aagcctcgtt

     5281 cggttcgtaa gctgtaatgc aagtagcgta actgccgtca cgcaactggt ccagaacctt

     5341 gaccgaacgc agcggtggta acggcgcagt ggcggttttc atggcttctt gttatgacat

     5401 gtttttttgg ggtacagtct atgcctcggg catccaagca gcaagcgcgt tacgccgtgg

     5461 gtcgatgttt gatgttatgg agcagcaacg atgttacgca gcagggcagt cgccctaaaa

     5521 caaagttaaa catcatgggg gaagcggtga tcgccgaagt atcgactcaa ctatcagagg

     5581 tagttggcgt catcgagcgc catctcgaac cgacgttgct ggccgtacat ttgtacggct

     5641 ccgcagtgga tggcggcctg aagccacaca gtgatattga tttgctggtt acggtgaccg

     5701 taaggcttga tgaaacaacg cggcgagctt tgatcaacga ccttttggaa acttcggctt

     5761 cccctggaga gagcgagatt ctccgcgctg tagaagtcac cattgttgtg cacgacgaca

     5821 tcattccgtg gcgttatcca gctaagcgcg aactgcaatt tggagaatgg cagcgcaatg

     5881 acattcttgc aggtatcttc gagccagcca cgatcgacat tgatctggct atcttgctga

     5941 caaaagcaag agaacatagc gttgccttgg taggtccagc ggcggaggaa ctctttgatc

     6001 cggttcctga acaggatcta tttgaggcgc taaatgaaac cttaacgcta tggaactcgc

     6061 cgcccgactg ggctggcgat gagcgaaatg tagtgcttac gttgtcccgc atttggtaca

     6121 gcgcagtaac cggcaaaatc gcgccgaagg atgtcgctgc cgactgggca atggagcgcc

     6181 tgccggccca gtatcagccc gtcatacttg aagctagaca ggcttatctt ggacaagaag

     6241 aagatcgctt ggcctcgcgc gcagatcagt tggaagaatt tgtccactac gtgaaaggcg

     6301 agatcaccaa ggtagtcggc aaataatgtc tagctagaaa ttcgttcaag ccgacgccgc

     6361 ttcgccggcg ttaactcaag cgattagatg cactaagcac ataattgctc acagccaaac

     6421 tatcaggtca agtctgcttt tattattttt aagcgtgcat aataagccct acacaaattg

     6481 ggagatatat catgcatgac caaaatccct taacgtgagt tttcgttcca ctgagcgtca

     6541 gaccccgtag aaaagatcaa aggatcttct tgagatcctt tttttctgcg cgtaatctgc

     6601 tgcttgcaaa caaaaaaacc accgctacca gcggtggttt gtttgccgga tcaagagcta

     6661 ccaactcttt ttccgaaggt aactggcttc agcagagcgc agataccaaa tactgtcctt

     6721 ctagtgtagc cgtagttagg ccaccacttc aagaactctg tagcaccgcc tacatacctc

     6781 gctctgctaa tcctgttacc agtggctgct gccagtggcg ataagtcgtg tcttaccggg

     6841 ttggactcaa gacgatagtt accggataag gcgcagcggt cgggctgaac ggggggttcg

     6901 tgcacacagc ccagcttgga gcgaacgacc tacaccgaac tgagatacct acagcgtgag

     6961 ctatgagaaa gcgccacgct tcccgaaggg agaaaggcgg acaggtatcc ggtaagcggc

     7021 agggtcggaa caggagagcg cacgagggag cttccagggg gaaacgcctg gtatctttat

     7081 agtcctgtcg ggtttcgcca cctctgactt gagcgtcgat ttttgtgatg ctcgtcaggg

     7141 gggcggagcc tatggaaaaa cgccagcaac gcggcctttt tacggttcct ggccttttgc

     7201 tggccttttg ctcacatgtt ctttcctgcg ttatcccctg attctgtgga taaccgtatt

     7261 accgcctttg agtgagctga taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca

     7321 gtgagcgagg aagcggaaga gcgcctgatg cggtattttc tccttacgca tctgtgcggt

     7381 atttcacacc gcatatggtg cactctcagt acaatctgct ctgatgccgc atagttaagc

     7441 cagtatacac tccgctatcg ctacgtgact gggtcatggc tgcgccccga cacccgccaa

     7501 cacccgctga cgcgccctga cgggcttgtc tgctcccggc atccgcttac agacaagctg

     7561 tgaccgtctc cgggagctgc atgtgtcaga ggttttcacc gtcatcaccg aaacgcgcga

     7621 ggcagggtgc cttgatgtgg gcgccggcgg tcgagtggcg acggcgcggc ttgtccgcgc

     7681 cctggtagat tgcctggccg taggccagcc atttttgagc ggccagcggc cgcgataggc

     7741 cgacgcgaag cggcggggcg tagggagcgc agcgaccgaa gggtaggcgc tttttgcagc

     7801 tcttcggctg tgcgctggcc agacagttat gcacaggcca ggcgggtttt aagagtttta

     7861 ataagtttta aagagtttta ggcggaaaaa tcgccttttt tctcttttat atcagtcact

     7921 tacatgtgtg accggttccc aatgtacggc tttgggttcc caatgtacgg gttccggttc

     7981 ccaatgtacg gctttgggtt cccaatgtac gtgctatcca caggaaagag accttttcga

     8041 cctttttccc ctgctagggc aatttgccct agcatctgct ccgtacatta ggaaccggcg

     8101 gatgcttcgc cctcgatcag gttgcggtag cgcatgacta ggatcgggcc agcctgcccc

     8161 gcctcctcct tcaaatcgta ctccggcagg tcatttgacc cgatcagctt gcgcacggtg

     8221 aaacagaact tcttgaactc tccggcgctg ccactgcgtt cgtagatcgt cttgaacaac

     8281 catctggctt ctgccttgcc tgcggcgcgg cgtgccaggc ggtagagaaa acggccgatg

     8341 ccgggatcga tcaaaaagta atcggggtga accgtcagca cgtccgggtt cttgccttct

     8401 gtgatctcgc ggtacatcca atcagctagc tcgatctcga tgtactccgg ccgcccggtt

     8461 tcgctcttta cgatcttgta gcggctaatc aaggcttcac cctcggatac cgtcaccagg

     8521 cggccgttct tggccttctt cgtacgctgc atggcaacgt gcgtggtgtt taaccgaatg

     8581 caggtttcta ccaggtcgtc tttctgcttt ccgccatcgg ctcgccggca gaacttgagt

     8641 acgtccgcaa cgtgtggacg gaacacgcgg ccgggcttgt ctcccttccc ttcccggtat

     8701 cggttcatgg attcggttag atgggaaacc gccatcagta ccaggtcgta atcccacaca

     8761 ctggccatgc cggccggccc tgcggaaacc tctacgtgcc cgtctggaag ctcgtagcgg

     8821 atcacctcgc cagctcgtcg gtcacgcttc gacagacgga aaacggccac gtccatgatg

     8881 ctgcgactat cgcgggtgcc cacgtcatag agcatcggaa cgaaaaaatc tggttgctcg

     8941 tcgcccttgg gcggcttcct aatcgacggc gcaccggctg ccggcggttg ccgggattct

     9001 ttgcggattc gatcagcggc cgcttgccac gattcaccgg ggcgtgcttc tgcctcgatg

     9061 cgttgccgct gggcggcctg cgcggccttc aacttctcca ccaggtcatc acccagcgcc

     9121 gcgccgattt gtaccgggcc ggatggtttg cgaccgtcac gccgattcct cgggcttggg

     9181 ggttccagtg ccattgcagg gccggcagac aacccagccg cttacgcctg gccaaccgcc

     9241 cgttcctcca cacatggggc attccacggc gtcggtgcct ggttgttctt gattttccat

     9301 gccgcctcct ttagccgcta aaattcatct actcatttat tcatttgctc atttactctg

     9361 gtagctgcgc gatgtattca gatagcagct cggtaatggt cttgccttgg cgtaccgcgt

     9421 acatcttcag cttggtgtga tcctccgccg gcaactgaaa gttgacccgc ttcatggctg

     9481 gcgtgtctgc caggctggcc aacgttgcag ccttgctgct gcgtgcgctc ggacggccgg

     9541 cacttagcgt gtttgtgctt ttgctcattt tctctttacc tcattaactc aaatgagttt

     9601 tgatttaatt tcagcggcca gcgcctggac ctcgcgggca gcgtcgccct cgggttctga

     9661 ttcaagaacg gttgtgccgg cggcggcagt gcctgggtag ctcacgcgct gcgtgatacg

     9721 ggactcaaga atgggcagct cgtacccggc cagcgcctcg gcaacctcac cgccgatgcg

     9781 cgtgcctttg atcgcccgcg acacgacaaa ggccgcttgt agccttccat ccgtgacctc

     9841 aatgcgctgc ttaaccagct ccaccaggtc ggcggtggcc catatgtcgt aagggcttgg

     9901 ctgcaccgga atcagcacga agtcggctgc cttgatcgcg gacacagcca agtccgccgc

     9961 ctggggcgct ccgtcgatca ctacgaagtc gcgccggccg atggccttca cgtcgcggtc

    10021 aatcgtcggg cggtcgatgc cgacaacggt tagcggttga tcttcccgca cggccgccca

    10081 atcgcgggca ctgccctggg gatcggaatc gactaacaga acatcggccc cggcgagttg

    10141 cagggcgcgg gctagatggg ttgcgatggt cgtcttgcct gacccgcctt tctggttaag

    10201 tacagcgata accttcatgc gttccccttg cgtatttgtt tatttactca tcgcatcata

    10261 tacgcagcga ccgcatgacg caagctgttt tactcaaata cacatcacct ttttagacgg

    10321 cggcgctcgg tttcttcagc ggccaagctg gccggccagg ccgccagctt ggcatcagac

    10381 aaaccggcca ggatttcatg cagccgcacg gttgagacgt gcgcgggcgg ctcgaacacg

    10441 tacccggccg cgatcatctc cgcctcgatc tcttcggtaa tgaaaaacgg ttcgtcctgg

    10501 ccgtcctggt gcggtttcat gcttgttcct cttggcgttc attctcggcg gccgccaggg

    10561 cgtcggcctc ggtcaatgcg tcctcacgga aggcaccgcg ccgcctggcc tcggtgggcg

    10621 tcacttcctc gctgcgctca agtgcgcggt acagggtcga gcgatgcacg ccaagcagtg

    10681 cagccgcctc tttcacggtg cggccttcct ggtcgatcag ctcgcgggcg tgcgcgatct

    10741 gtgccggggt gagggtaggg cgggggccaa acttcacgcc tcgggccttg gcggcctcgc

    10801 gcccgctccg ggtgcggtcg atgattaggg aacgctcgaa ctcggcaatg ccggcgaaca

    10861 cggtcaacac catgcggccg gccggcgtgg tggtgtcggc ccacggctct gccaggctac

    10921 gcaggcccgc gccggcctcc tggatgcgct cggcaatgtc cagtaggtcg cgggtgctgc

    10981 gggccaggcg gtctagcctg gtcactgtca caacgtcgcc agggcgtagg tggtcaagca

    11041 tcctggccag ctccgggcgg tcgcgcctgg tgccggtgat cttctcggaa aacagcttgg

    11101 tgcagccggc cgcgtgcagt tcggcccgtt ggttggtcaa gtcctggtcg tcggtgctga

    11161 cgcgggcata gcccagcagg ccagcggcgg cgctcttgtt catggcgtaa tgtctccggt

    11221 tctagtcgca agtattctac tttatgcgac taaaacacgc gacaagaaaa cgccaggaaa

    11281 agggcagggc ggcagcctgt cgcgtaactt aggacttgtg cgacatgtcg ttttcagaag

    11341 acggctgcac tgaacgtcag aagccgactg cactatagca gcggaggggt tggatcaaag

    11401 tactttgatc ccgaggggaa ccctgtggtt ggcatgcaca tacaaatgga cgaacggata

    11461 aaccttttca cgccctttta aatatccgtt attctaataa acgctctttt ctcttag

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart