pET- NLS- Cas9- 6xHis

$193.00

  • Model: PVT10639
  • 50 Units in Stock
Ask a question


Add to Cart:

pET-NLS-Cas9-6xHis


PVT10639   Packing 2ug

 

pET-NLS-Cas9-6xHis Information

Prokaryotic resistance: ampicillin Amp

Clone strain: Escherichia coli Stbl3

Culture conditions: 37 C

 

pET-NLS-Cas9-6xHis Description

PET-NLS-Cas9-6xHis is an Escherichia coli Cas9 expression plasmid.

 

pET-NLS-Cas9-6xHis Sequence

LOCUS       Exported                9289 bp ds-DNA     circular SYN 09-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..9289

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     protein_bind    3..27

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     RBS             42..64

                     /note="efficient ribosome binding site from bacteriophage 

                     T7 gene 10 (Olins and Rangwala, 1989)"

     CDS             74..94

                     /codon_start=1

                     /product="nuclear localization signal of SV40 large T 

                     antigen"

                     /label=SV40 NLS

                     /translation="PKKKRKV"

     CDS             95..4198

                     /codon_start=1

                     /product="Cas9 (Csn1) endonuclease from the Streptococcus 

                     pyogenes Type II CRISPR/Cas system"

                     /label=Cas9

                     /note="generates RNA-guided double strand breaks in DNA"

                     /translation="MDKKYSIGLDIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK

                     NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEES

                     FLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIK

                     FRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL

                     ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ

                     IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVR

                     QQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLL

                     RKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARG

                     NSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEY

                     FTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFD

                     SVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEER

                     LKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFM

                     QLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR

                     HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY

                     LYYLQNGRDMYVDQELDINRLSDYDVDHIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVP

                     SEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKH

                     VAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYL

                     NAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT

                     EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSK

                     ESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGI

                     TIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE

                     LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILAD

                     ANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL

                     DATLIHQSITGLYETRIDLSQLGGD"

     CDS             4199..4216

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      4331..4378

                     /label=T7 terminator

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

     rep_origin      4415..4870

                     /direction=RIGHT

                     /label=f1 ori

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     CDS             complement(4985..5845)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(5846..5938)

                     /gene="bla"

                     /label=AmpR promoter

     rep_origin      6019..6607

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    6793..6935

                     /label=bom

                     /note="basis of mobility region from pBR322"

     CDS             complement(7037..7228)

                     /codon_start=1

                     /gene="rop"

                     /product="Rop protein, which maintains plasmids at low copy

                     number"

                     /label=rop

                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

                     DELYRSCLARFGDDGENL"

     CDS             complement(7800..8882)

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /label=lacI

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPLTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     promoter        complement(8883..8960)

                     /gene="lacI"

                     /label=lacI promoter

     promoter        9273..2

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

ORIGIN

        1 ggggaattgt gagcggataa caattcccct ctagaaataa ttttgtttaa ctttaagaag

       61 gagatatacc atgcccaaga agaagaggaa ggtgatggat aagaaatact caataggctt

      121 agatatcggc acaaatagcg tcggatgggc ggtgatcact gatgaatata aggttccgtc

      181 taaaaagttc aaggttctgg gaaatacaga ccgccacagt atcaaaaaaa atcttatagg

      241 ggctctttta tttgacagtg gagagacagc ggaagcgact cgtctcaaac ggacagctcg

      301 tagaaggtat acacgtcgga agaatcgtat ttgttatcta caggagattt tttcaaatga

      361 gatggcgaaa gtagatgata gtttctttca tcgacttgaa gagtcttttt tggtggaaga

      421 agacaagaag catgaacgtc atcctatttt tggaaatata gtagatgaag ttgcttatca

      481 tgagaaatat ccaactatct atcatctgcg aaaaaaattg gtagattcta ctgataaagc

      541 ggatttgcgc ttaatctatt tggccttagc gcatatgatt aagtttcgtg gtcatttttt

      601 gattgaggga gatttaaatc ctgataatag tgatgtggac aaactattta tccagttggt

      661 acaaacctac aatcaattat ttgaagaaaa ccctattaac gcaagtggag tagatgctaa

      721 agcgattctt tctgcacgat tgagtaaatc aagacgatta gaaaatctca ttgctcagct

      781 ccccggtgag aagaaaaatg gcttatttgg gaatctcatt gctttgtcat tgggtttgac

      841 ccctaatttt aaatcaaatt ttgatttggc agaagatgct aaattacagc tttcaaaaga

      901 tacttacgat gatgatttag ataatttatt ggcgcaaatt ggagatcaat atgctgattt

      961 gtttttggca gctaagaatt tatcagatgc tattttactt tcagatatcc taagagtaaa

     1021 tactgaaata actaaggctc ccctatcagc ttcaatgatt aaacgctacg atgaacatca

     1081 tcaagacttg actcttttaa aagctttagt tcgacaacaa cttccagaaa agtataaaga

     1141 aatctttttt gatcaatcaa aaaacggata tgcaggttat attgatgggg gagctagcca

     1201 agaagaattt tataaattta tcaaaccaat tttagaaaaa atggatggta ctgaggaatt

     1261 attggtgaaa ctaaatcgtg aagatttgct gcgcaagcaa cggacctttg acaacggctc

     1321 tattccccat caaattcact tgggtgagct gcatgctatt ttgagaagac aagaagactt

     1381 ttatccattt ttaaaagaca atcgtgagaa gattgaaaaa atcttgactt ttcgaattcc

     1441 ttattatgtt ggtccattgg cgcgtggcaa tagtcgtttt gcatggatga ctcggaagtc

     1501 tgaagaaaca attaccccat ggaattttga agaagttgtc gataaaggtg cttcagctca

     1561 atcatttatt gaacgcatga caaactttga taaaaatctt ccaaatgaaa aagtactacc

     1621 aaaacatagt ttgctttatg agtattttac ggtttataac gaattgacaa aggtcaaata

     1681 tgttactgaa ggaatgcgaa aaccagcatt tctttcaggt gaacagaaga aagccattgt

     1741 tgatttactc ttcaaaacaa atcgaaaagt aaccgttaag caattaaaag aagattattt

     1801 caaaaaaata gaatgttttg atagtgttga aatttcagga gttgaagata gatttaatgc

     1861 ttcattaggt acctaccatg atttgctaaa aattattaaa gataaagatt ttttggataa

     1921 tgaagaaaat gaagatatct tagaggatat tgttttaaca ttgaccttat ttgaagatag

     1981 ggagatgatt gaggaaagac ttaaaacata tgctcacctc tttgatgata aggtgatgaa

     2041 acagcttaaa cgtcgccgtt atactggttg gggacgtttg tctcgaaaat tgattaatgg

     2101 tattagggat aagcaatctg gcaaaacaat attagatttt ttgaaatcag atggttttgc

     2161 caatcgcaat tttatgcagc tgatccatga tgatagtttg acatttaaag aagacattca

     2221 aaaagcacaa gtgtctggac aaggcgatag tttacatgaa catattgcaa atttagctgg

     2281 tagccctgct attaaaaaag gtattttaca gactgtaaaa gttgttgatg aattggtcaa

     2341 agtaatgggg cggcataagc cagaaaatat cgttattgaa atggcacgtg aaaatcagac

     2401 aactcaaaag ggccagaaaa attcgcgaga gcgtatgaaa cgaatcgaag aaggtatcaa

     2461 agaattagga agtcagattc ttaaagagca tcctgttgaa aatactcaat tgcaaaatga

     2521 aaagctctat ctctattatc tccaaaatgg aagagacatg tatgtggacc aagaattaga

     2581 tattaatcgt ttaagtgatt atgatgtcga tcacattgtt ccacaaagtt tccttaaaga

     2641 cgattcaata gacaataagg tcttaacgcg ttctgataaa aatcgtggta aatcggataa

     2701 cgttccaagt gaagaagtag tcaaaaagat gaaaaactat tggagacaac ttctaaacgc

     2761 caagttaatc actcaacgta agtttgataa tttaacgaaa gctgaacgtg gaggtttgag

     2821 tgaacttgat aaagctggtt ttatcaaacg ccaattggtt gaaactcgcc aaatcactaa

     2881 gcatgtggca caaattttgg atagtcgcat gaatactaaa tacgatgaaa atgataaact

     2941 tattcgagag gttaaagtga ttaccttaaa atctaaatta gtttctgact tccgaaaaga

     3001 tttccaattc tataaagtac gtgagattaa caattaccat catgcccatg atgcgtatct

     3061 aaatgccgtc gttggaactg ctttgattaa gaaatatcca aaacttgaat cggagtttgt

     3121 ctatggtgat tataaagttt atgatgttcg taaaatgatt gctaagtctg agcaagaaat

     3181 aggcaaagca accgcaaaat atttctttta ctctaatatc atgaacttct tcaaaacaga

     3241 aattacactt gcaaatggag agattcgcaa acgccctcta atcgaaacta atggggaaac

     3301 tggagaaatt gtctgggata aagggcgaga ttttgccaca gtgcgcaaag tattgtccat

     3361 gccccaagtc aatattgtca agaaaacaga agtacagaca ggcggattct ccaaggagtc

     3421 aattttacca aaaagaaatt cggacaagct tattgctcgt aaaaaagact gggatccaaa

     3481 aaaatatggt ggttttgata gtccaacggt agcttattca gtcctagtgg ttgctaaggt

     3541 ggaaaaaggg aaatcgaaga agttaaaatc cgttaaagag ttactaggga tcacaattat

     3601 ggaaagaagt tcctttgaaa aaaatccgat tgacttttta gaagctaaag gatataagga

     3661 agttaaaaaa gacttaatca ttaaactacc taaatatagt ctttttgagt tagaaaacgg

     3721 tcgtaaacgg atgctggcta gtgccggaga attacaaaaa ggaaatgagc tggctctgcc

     3781 aagcaaatat gtgaattttt tatatttagc tagtcattat gaaaagttga agggtagtcc

     3841 agaagataac gaacaaaaac aattgtttgt tgagcagcat aagcattatt tagatgagat

     3901 tattgagcaa atcagtgaat tttctaagcg tgttatttta gcagatgcca atttagataa

     3961 agttcttagt gcatataaca aacatagaga caaaccaata cgtgaacaag cagaaaatat

     4021 tattcattta tttacgttga cgaatcttgg agctcccgct gcttttaaat attttgatac

     4081 aacaattgat cgtaaacgat atacgtctac aaaagaagtt ttagatgcca ctcttatcca

     4141 tcaatccatc actggtcttt atgaaacacg cattgatttg agtcagctag gaggtgacca

     4201 tcaccaccac catcactaat gactcgagtc tggtaaagaa accgctgctg cgaaatttga

     4261 acgccagcac atggactcgt ctactagcgc agcttaatta acctaggctg ctgccaccgc

     4321 tgagcaataa ctagcataac cccttggggc ctctaaacgg gtcttgaggg gttttttgct

     4381 gaaaggagga actatatccg gattggcgaa tgggacgcgc cctgtagcgg cgcattaagc

     4441 gcggcgggtg tggtggttac gcgcagcgtg accgctacac ttgccagcgc cctagcgccc

     4501 gctcctttcg ctttcttccc ttcctttctc gccacgttcg ccggctttcc ccgtcaagct

     4561 ctaaatcggg ggctcccttt agggttccga tttagtgctt tacggcacct cgaccccaaa

     4621 aaacttgatt agggtgatgg ttcacgtagt gggccatcgc cctgatagac ggtttttcgc

     4681 cctttgacgt tggagtccac gttctttaat agtggactct tgttccaaac tggaacaaca

     4741 ctcaacccta tctcggtcta ttcttttgat ttataaggga ttttgccgat ttcggcctat

     4801 tggttaaaaa atgagctgat ttaacaaaaa tttaacgcga attttaacaa aatattaacg

     4861 tttacaattt ctggcggcac gatggcatga gattatcaaa aaggatcttc acctagatcc

     4921 ttttaaatta aaaatgaagt tttaaatcaa tctaaagtat atatgagtaa acttggtctg

     4981 acagttacca atgcttaatc agtgaggcac ctatctcagc gatctgtcta tttcgttcat

     5041 ccatagttgc ctgactcccc gtcgtgtaga taactacgat acgggagggc ttaccatctg

     5101 gccccagtgc tgcaatgata ccgcgagacc cacgctcacc ggctccagat ttatcagcaa

     5161 taaaccagcc agccggaagg gccgagcgca gaagtggtcc tgcaacttta tccgcctcca

     5221 tccagtctat taattgttgc cgggaagcta gagtaagtag ttcgccagtt aatagtttgc

     5281 gcaacgttgt tgccattgct acaggcatcg tggtgtcacg ctcgtcgttt ggtatggctt

     5341 cattcagctc cggttcccaa cgatcaaggc gagttacatg atcccccatg ttgtgcaaaa

     5401 aagcggttag ctccttcggt cctccgatcg ttgtcagaag taagttggcc gcagtgttat

     5461 cactcatggt tatggcagca ctgcataatt ctcttactgt catgccatcc gtaagatgct

     5521 tttctgtgac tggtgagtac tcaaccaagt cattctgaga atagtgtatg cggcgaccga

     5581 gttgctcttg cccggcgtca atacgggata ataccgcgcc acatagcaga actttaaaag

     5641 tgctcatcat tggaaaacgt tcttcggggc gaaaactctc aaggatctta ccgctgttga

     5701 gatccagttc gatgtaaccc actcgtgcac ccaactgatc ttcagcatct tttactttca

     5761 ccagcgtttc tgggtgagca aaaacaggaa ggcaaaatgc cgcaaaaaag ggaataaggg

     5821 cgacacggaa atgttgaata ctcatactct tcctttttca atcatgattg aagcatttat

     5881 cagggttatt gtctcatgag cggatacata tttgaatgta tttagaaaaa taaacaaata

     5941 ggtcatgacc aaaatccctt aacgtgagtt ttcgttccac tgagcgtcag accccgtaga

     6001 aaagatcaaa ggatcttctt gagatccttt ttttctgcgc gtaatctgct gcttgcaaac

     6061 aaaaaaacca ccgctaccag cggtggtttg tttgccggat caagagctac caactctttt

     6121 tccgaaggta actggcttca gcagagcgca gataccaaat actgtccttc tagtgtagcc

     6181 gtagttaggc caccacttca agaactctgt agcaccgcct acatacctcg ctctgctaat

     6241 cctgttacca gtggctgctg ccagtggcga taagtcgtgt cttaccgggt tggactcaag

     6301 acgatagtta ccggataagg cgcagcggtc gggctgaacg gggggttcgt gcacacagcc

     6361 cagcttggag cgaacgacct acaccgaact gagataccta cagcgtgagc tatgagaaag

     6421 cgccacgctt cccgaaggga gaaaggcgga caggtatccg gtaagcggca gggtcggaac

     6481 aggagagcgc acgagggagc ttccaggggg aaacgcctgg tatctttata gtcctgtcgg

     6541 gtttcgccac ctctgacttg agcgtcgatt tttgtgatgc tcgtcagggg ggcggagcct

     6601 atggaaaaac gccagcaacg cggccttttt acggttcctg gccttttgct ggccttttgc

     6661 tcacatgttc tttcctgcgt tatcccctga ttctgtggat aaccgtatta ccgcctttga

     6721 gtgagctgat accgctcgcc gcagccgaac gaccgagcgc agcgagtcag tgagcgagga

     6781 agcggaagag cgcctgatgc ggtattttct ccttacgcat ctgtgcggta tttcacaccg

     6841 catatatggt gcactctcag tacaatctgc tctgatgccg catagttaag ccagtataca

     6901 ctccgctatc gctacgtgac tgggtcatgg ctgcgccccg acacccgcca acacccgctg

     6961 acgcgccctg acgggcttgt ctgctcccgg catccgctta cagacaagct gtgaccgtct

     7021 ccgggagctg catgtgtcag aggttttcac cgtcatcacc gaaacgcgcg aggcagctgc

     7081 ggtaaagctc atcagcgtgg tcgtgaagcg attcacagat gtctgcctgt tcatccgcgt

     7141 ccagctcgtt gagtttctcc agaagcgtta atgtctggct tctgataaag cgggccatgt

     7201 taagggcggt tttttcctgt ttggtcactg atgcctccgt gtaaggggga tttctgttca

     7261 tgggggtaat gataccgatg aaacgagaga ggatgctcac gatacgggtt actgatgatg

     7321 aacatgcccg gttactggaa cgttgtgagg gtaaacaact ggcggtatgg atgcggcggg

     7381 accagagaaa aatcactcag ggtcaatgcc agcgcttcgt taatacagat gtaggtgttc

     7441 cacagggtag ccagcagcat cctgcgatgc agatccggaa cataatggtg cagggcgctg

     7501 acttccgcgt ttccagactt tacgaaacac ggaaaccgaa gaccattcat gttgttgctc

     7561 aggtcgcaga cgttttgcag cagcagtcgc ttcacgttcg ctcgcgtatc ggtgattcat

     7621 tctgctaacc agtaaggcaa ccccgccagc ctagccgggt cctcaacgac aggagcacga

     7681 tcatgctagt catgccccgc gcccaccgga aggagctgac tgggttgaag gctctcaagg

     7741 gcatcggtcg agatcccggt gcctaatgag tgagctaact tacattaatt gcgttgcgct

     7801 cactgcccgc tttccagtcg ggaaacctgt cgtgccagct gcattaatga atcggccaac

     7861 gcgcggggag aggcggtttg cgtattgggc gccagggtgg tttttctttt caccagtgag

     7921 acgggcaaca gctgattgcc cttcaccgcc tggccctgag agagttgcag caagcggtcc

     7981 acgctggttt gccccagcag gcgaaaatcc tgtttgatgg tggttaacgg cgggatataa

     8041 catgagctgt cttcggtatc gtcgtatccc actaccgaga tgtccgcacc aacgcgcagc

     8101 ccggactcgg taatggcgcg cattgcgccc agcgccatct gatcgttggc aaccagcatc

     8161 gcagtgggaa cgatgccctc attcagcatt tgcatggttt gttgaaaacc ggacatggca

     8221 ctccagtcgc cttcccgttc cgctatcggc tgaatttgat tgcgagtgag atatttatgc

     8281 cagccagcca gacgcagacg cgccgagaca gaacttaatg ggcccgctaa cagcgcgatt

     8341 tgctggtgac ccaatgcgac cagatgctcc acgcccagtc gcgtaccgtc ttcatgggag

     8401 aaaataatac tgttgatggg tgtctggtca gagacatcaa gaaataacgc cggaacatta

     8461 gtgcaggcag cttccacagc aatggcatcc tggtcatcca gcggatagtt aatgatcagc

     8521 ccactgacgc gttgcgcgag aagattgtgc accgccgctt tacaggcttc gacgccgctt

     8581 cgttctacca tcgacaccac cacgctggca cccagttgat cggcgcgaga tttaatcgcc

     8641 gcgacaattt gcgacggcgc gtgcagggcc agactggagg tggcaacgcc aatcagcaac

     8701 gactgtttgc ccgccagttg ttgtgccacg cggttgggaa tgtaattcag ctccgccatc

     8761 gccgcttcca ctttttcccg cgttttcgca gaaacgtggc tggcctggtt caccacgcgg

     8821 gaaacggtct gataagagac accggcatac tctgcgacat cgtataacgt tactggtttc

     8881 acattcacca ccctgaattg actctcttcc gggcgctatc atgccatacc gcgaaaggtt

     8941 ttgcgccatt cgatggtgtc cgggatctcg acgctctccc ttatgcgact cctgcattag

     9001 gaagcagccc agtagtaggt tgaggccgtt gagcaccgcc gccgcaagga atggtgcatg

     9061 caaggagatg gcgcccaaca gtcccccggc cacggggcct gccaccatac ccacgccgaa

     9121 acaagcgctc atgagcccga agtggcgagc ccgatcttcc ccatcggtga tgtcggcgat

     9181 ataggcgcca gcaaccgcac ctgtggcgcc ggtgatgccg gccacgatgc gtccggcgta

     9241 gaggatcgag atcgatctcg atcccgcgaa attaatacga ctcactata

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart