pETM- 41

$260.00

  • Model: PVT10588
  • 50 Units in Stock
Ask a question


Add to Cart:

pETM-41

Catalog No. PVT10588
Packing 2ug

 

PETM-41 Information

Function E.coli expression plasmid

Alias: pETM41

Promoter: T7 promoter

Replicon: pBR322

Terminator: T7 Terminator

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

 

PETM-41 Description

PETM-41 is an Escherichia coli pET expression plasmid.

pETM-41

 

PETM-41 Sequence

LOCUS       Exported                5441 bp ds-DNA     circular SYN 26-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..5441

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(4..819)

                     /codon_start=1

                     /gene="aph(3')-Ia"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin in bacteria or G418 

                     (Geneticin(R)) in eukaryotes"

                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG

                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK

                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA

                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI

                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"

     rep_origin      941..1529

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    1715..1857

                     /label=bom

                     /note="basis of mobility region from pBR322"

     CDS             complement(1959..2150)

                     /codon_start=1

                     /gene="rop"

                     /product="Rop protein, which maintains plasmids at low copy

                     number"

                     /label=rop

                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

                     DELYRSCLARFGDDGENL"

     promoter        3711..3729

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     RBS             3761..3783

                     /note="efficient ribosome binding site from bacteriophage 

                     T7 gene 10 (Olins and Rangwala, 1989)"

     CDS             3796..3813

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     CDS             3817..4917

                     /codon_start=1

                     /gene="malE (mutated)"

                     /product="maltose binding protein from E. coli"

                     /label=MBP

                     /note="This version of the gene does not encode a signal 

                     sequence, so MBP will remain in the cytosol."

                     /translation="MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLE

                     EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKL

                     IAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA

                     ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGE

                     TAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL

                     ENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAF

                     WYAVRTAVINAASGRQTVDEALKDAQT"

     CDS             4969..4989

                     /codon_start=1

                     /product="tobacco etch virus (TEV) protease recognition and

                     cleavage site"

                     /label=TEV site

                     /translation="ENLYFQG"

     misc_feature    4991..5049

                     /label=MCS

     CDS             5057..5074

                     /codon_start=1

                     /product="6xHis affinity tag"

                     /label=6xHis

                     /translation="HHHHHH"

     terminator      5141..5188

                     /label=T7 terminator

                     /note="transcription terminator for bacteriophage T7 RNA 

                     polymerase"

ORIGIN

        1 ttcttagaaa aactcatcga gcatcaaatg aaactgcaat ttattcatat caggattatc

       61 aataccatat ttttgaaaaa gccgtttctg taatgaagga gaaaactcac cgaggcagtt

      121 ccataggatg gcaagatcct ggtatcggtc tgcgattccg actcgtccaa catcaataca

      181 acctattaat ttcccctcgt caaaaataag gttatcaagt gagaaatcac catgagtgac

      241 gactgaatcc ggtgagaatg gcaaaagctt atgcatttct ttccagactt gttcaacagg

      301 ccagccatta cgctcgtcat caaaatcact cgcatcaacc aaaccgttat tcattcgtga

      361 ttgcgcctga gcgagacgaa atacgcgatc gctgttaaaa ggacaattac aaacaggaat

      421 cgaatgcaac cggcgcagga acactgccag cgcatcaaca atattttcac ctgaatcagg

      481 atattcttct aatacctgga atgctgtttt cccggggatc gcagtggtga gtaaccatgc

      541 atcatcagga gtacggataa aatgcttgat ggtcggaaga ggcataaatt ccgtcagcca

      601 gtttagtctg accatctcat ctgtaacatc attggcaacg ctacctttgc catgtttcag

      661 aaacaactct ggcgcatcgg gcttcccata caatcgatag attgtcgcac ctgattgccc

      721 gacattatcg cgagcccatt tatacccata taaatcagca tccatgttgg aatttaatcg

      781 cggcctcgag caagacgttt cccgttgaat atggctcata acaccccttg tattactgtt

      841 tatgtaagca gacagtttta ttgttcatga ccaaaatccc ttaacgtgag ttttcgttcc

      901 actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc

      961 gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg

     1021 atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa

     1081 atactgtcct tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc

     1141 ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt

     1201 gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa

     1261 cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc

     1321 tacagcgtga gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc

     1381 cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct

     1441 ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat

     1501 gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc

     1561 tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg

     1621 ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc

     1681 gcagcgagtc agtgagcgag gaagcggaag agcgcctgat gcggtatttt ctccttacgc

     1741 atctgtgcgg tatttcacac cgcatatatg gtgcactctc agtacaatct gctctgatgc

     1801 cgcatagtta agccagtata cactccgcta tcgctacgtg actgggtcat ggctgcgccc

     1861 cgacacccgc caacacccgc tgacgcgccc tgacgggctt gtctgctccc ggcatccgct

     1921 tacagacaag ctgtgaccgt ctccgggagc tgcatgtgtc agaggttttc accgtcatca

     1981 ccgaaacgcg cgaggcagct gcggtaaagc tcatcagcgt ggtcgtgaag cgattcacag

     2041 atgtctgcct gttcatccgc gtccagctcg ttgagtttct ccagaagcgt taatgtctgg

     2101 cttctgataa agcgggccat gttaagggcg gttttttcct gtttggtcac tgatgcctcc

     2161 gtgtaagggg gatttctgtt catgggggta atgataccga tgaaacgaga gaggatgctc

     2221 acgatacggg ttactgatga tgaacatgcc cggttactgg aacgttgtga gggtaaacaa

     2281 ctggcggtat ggatgcggcg ggaccagaga aaaatcactc agggtcaatg ccagcgcttc

     2341 gttaatacag atgtaggtgt tccacagggt agccagcagc atcctgcgat gcagatccgg

     2401 aacataatgg tgcagggcgc tgacttccgc gtttccagac tttacgaaac acggaaaccg

     2461 aagaccattc atgttgttgc tcaggtcgca gacgttttgc agcagcagtc gcttcacgtt

     2521 cgctcgcgta tcggtgattc attctgctaa ccagtaaggc aaccccgcca gcctagccgg

     2581 gtcctcaacg acaggagcac gatcatgcgc acccgtggcc aggacccaac gctgcccgag

     2641 atgcgccgcg tgcggctgct ggagatggcg gacgcgatgg atatgttctg ccaagggttg

     2701 gtttgcgcat tcacagttct ccgcaagaat tgattggctc caattcttgg agtggtgaat

     2761 ccgttagcga ggtgccgccg gcttccattc aggtcgaggt ggcccggctc catgcaccgc

     2821 gacgcaacgc ggggaggcag acaaggtata gggcggcgcc tacaatccat gccaacccgt

     2881 tccatgtgct cgccgaggcg gcataaatcg ccgtgacgat cagcggtcca gtgatcgaag

     2941 ttaggctggt aagagccgcg agcgatcctt gaagctgtcc ctgatggtcg tcatctacct

     3001 gcctggacag catggcctgc aacgcgggca tcccgatgcc gccggaagcg agaagaatca

     3061 taatggggaa ggccatccag cctcgcgtcg cgaacgccag caagacgtag cccagcgcgt

     3121 cggccgccat gccggcgata atggcctgct tctcgccgaa acgtttggtg gcgggaccag

     3181 tgacgaaggc ttgagcgagg gcgtgcaaga ttccgaatac cgcaagcgac aggccgatca

     3241 tcgtcgcgct ccagcgaaag cggtcctcgc cgaaaatgac ccagagcgct gccggcacct

     3301 gtcctacgag ttgcatgata aagaagacag tcataagtgc ggcgacgata gtcatgcccc

     3361 gcgcccaccg gaaggagctg actgggttga aggctctcaa gggcatcggt cgacgctctc

     3421 ccttatgcga ctcctgcatt aggaagcagc ccagtagtag gttgaggccg ttgagcaccg

     3481 ccgccgcaag gaatggtgca tgcaaggaga tggcgcccaa cagtcccccg gccacggggc

     3541 ctgccaccat acccacgccg aaacaagcgc tcatgagccc gaagtggcga gcccgatctt

     3601 ccccatcggt gatgtcggcg atataggcgc cagcaaccgc acctgtggcg ccggtgatgc

     3661 cggccacgat gcgtccggcg tagaggatcg agatctcgat cccgcgaaat taatacgact

     3721 cactataggg agaccacaac ggtttccctc tagaaataat tttgtttaac tttaagaagg

     3781 agatatacca tgaaacatca ccatcaccat caccccatga aaatcgaaga aggtaaactg

     3841 gtaatctgga ttaacggcga taaaggctat aacggtctcg ctgaagtcgg taagaaattc

     3901 gagaaagata ccggaattaa agtcaccgtt gagcatccgg ataaactgga agagaaattc

     3961 ccacaggttg cggcaactgg cgatggccct gacattatct tctgggcaca cgaccgcttt

     4021 ggtggctacg ctcaatctgg cctgttggct gaaatcaccc cggacaaagc gttccaggac

     4081 aagctgtatc cgtttacctg ggatgccgta cgttacaacg gcaagctgat tgcttacccg

     4141 atcgctgttg aagcgttatc gctgatttat aacaaagatc tgctgccgaa cccgccaaaa

     4201 acctgggaag agatcccggc gctggataaa gaactgaaag cgaaaggtaa gagcgcgctg

     4261 atgttcaacc tgcaagaacc gtacttcacc tggccgctga ttgctgctga cgggggttat

     4321 gcgttcaagt atgaaaacgg caagtacgac attaaagacg tgggcgtgga taacgctggc

     4381 gcgaaagcgg gtctgacctt cctggttgac ctgattaaaa acaaacacat gaatgcagac

     4441 accgattact ccatcgcaga agctgccttt aataaaggcg aaacagcgat gaccatcaac

     4501 ggcccgtggg catggtccaa catcgacacc agcaaagtga attatggtgt aacggtactg

     4561 ccgaccttca agggtcaacc atccaaaccg ttcgttggcg tgctgagcgc aggtattaac

     4621 gccgccagtc cgaacaaaga gctggcaaaa gagttcctcg aaaactatct gctgactgat

     4681 gaaggtctgg aagcggttaa taaagacaaa ccgctgggtg ccgtagcgct gaagtcttac

     4741 gaggaagagt tggcgaaaga tccacgtatt gccgccacta tggaaaacgc ccagaaaggt

     4801 gaaatcatgc cgaacatccc gcagatgtcc gctttctggt atgccgtgcg tactgcggtg

     4861 atcaacgccg ccagcggtcg tcagactgtc gatgaagccc tgaaagacgc gcagactaat

     4921 tcgagctcga acaacaacaa caataacaat aacaacaacc ccatgagcga gaatctttat

     4981 tttcagggcg ccatggacta atgaggtacc ggatccgaat tcgagctccg tcgacaagct

     5041 tgcggccgca ctcgagcacc accaccacca ccactgagat ccggctgcta acaaagcccg

     5101 aaaggaagct gagttggctg ctgccaccgc tgagcaataa ctagcataac cccttggggc

     5161 ctctaaacgg gtcttgaggg gttttttgct gaaaggagga actatatccg gatatccaca

     5221 ggacgggtgt ggtcgccatg atcgcgtagt cgatagtggc tccaagtagc gaagcgagca

     5281 ggactgggcg gcggccaaag cggtcggaca gtgctccgag aacgggtgcg catagaaatt

     5341 gcatcaacgc atatagcgct agcagcacgc catagtgact ggcgatgctg tcggaatgga

     5401 cgatatcccg caagaggccc ggcagtaccg gcataaccaa g

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart