pETM- 41

$260.00

  • Model: PVT10588
  • 50 Units in Stock
Ask a question


Add to Cart:

pETM-41

Catalog No. PVT10588
Packing 2ug

 

PETM-41 Information

Function E.coli expression plasmid

Alias: pETM41

Promoter: T7 promoter

Replicon: pBR322

Terminator: T7 Terminator

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

 

PETM-41 Description

PETM-41 is an Escherichia coli pET expression plasmid.

pETM-41

 

 

PETM-41 Sequence

LOCUS       Exported                5441 bp ds-DNA     circular SYN 26-DEC-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..5441
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(4..819)
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      941..1529
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     misc_feature    1715..1857
                     /label=bom
                     /note="basis of mobility region from pBR322"
     CDS             complement(1959..2150)
                     /codon_start=1
                     /gene="rop"
                     /product="Rop protein, which maintains plasmids at low copy
                     number"
                     /label=rop
                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA
                     DELYRSCLARFGDDGENL"
     promoter        3711..3729
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     RBS             3761..3783
                     /note="efficient ribosome binding site from bacteriophage 
                     T7 gene 10 (Olins and Rangwala, 1989)"
     CDS             3796..3813
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     CDS             3817..4917
                     /codon_start=1
                     /gene="malE (mutated)"
                     /product="maltose binding protein from E. coli"
                     /label=MBP
                     /note="This version of the gene does not encode a signal 
                     sequence, so MBP will remain in the cytosol."
                     /translation="MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLE
                     EKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKL
                     IAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIA
                     ADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGE
                     TAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFL
                     ENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAF
                     WYAVRTAVINAASGRQTVDEALKDAQT"
     CDS             4969..4989
                     /codon_start=1
                     /product="tobacco etch virus (TEV) protease recognition and
                     cleavage site"
                     /label=TEV site
                     /translation="ENLYFQG"
     misc_feature    4991..5049
                     /label=MCS
     CDS             5057..5074
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     terminator      5141..5188
                     /label=T7 terminator
                     /note="transcription terminator for bacteriophage T7 RNA 
                     polymerase"
ORIGIN
        1 ttcttagaaa aactcatcga gcatcaaatg aaactgcaat ttattcatat caggattatc
       61 aataccatat ttttgaaaaa gccgtttctg taatgaagga gaaaactcac cgaggcagtt
      121 ccataggatg gcaagatcct ggtatcggtc tgcgattccg actcgtccaa catcaataca
      181 acctattaat ttcccctcgt caaaaataag gttatcaagt gagaaatcac catgagtgac
      241 gactgaatcc ggtgagaatg gcaaaagctt atgcatttct ttccagactt gttcaacagg
      301 ccagccatta cgctcgtcat caaaatcact cgcatcaacc aaaccgttat tcattcgtga
      361 ttgcgcctga gcgagacgaa atacgcgatc gctgttaaaa ggacaattac aaacaggaat
      421 cgaatgcaac cggcgcagga acactgccag cgcatcaaca atattttcac ctgaatcagg
      481 atattcttct aatacctgga atgctgtttt cccggggatc gcagtggtga gtaaccatgc
      541 atcatcagga gtacggataa aatgcttgat ggtcggaaga ggcataaatt ccgtcagcca
      601 gtttagtctg accatctcat ctgtaacatc attggcaacg ctacctttgc catgtttcag
      661 aaacaactct ggcgcatcgg gcttcccata caatcgatag attgtcgcac ctgattgccc
      721 gacattatcg cgagcccatt tatacccata taaatcagca tccatgttgg aatttaatcg
      781 cggcctcgag caagacgttt cccgttgaat atggctcata acaccccttg tattactgtt
      841 tatgtaagca gacagtttta ttgttcatga ccaaaatccc ttaacgtgag ttttcgttcc
      901 actgagcgtc agaccccgta gaaaagatca aaggatcttc ttgagatcct ttttttctgc
      961 gcgtaatctg ctgcttgcaa acaaaaaaac caccgctacc agcggtggtt tgtttgccgg
     1021 atcaagagct accaactctt tttccgaagg taactggctt cagcagagcg cagataccaa
     1081 atactgtcct tctagtgtag ccgtagttag gccaccactt caagaactct gtagcaccgc
     1141 ctacatacct cgctctgcta atcctgttac cagtggctgc tgccagtggc gataagtcgt
     1201 gtcttaccgg gttggactca agacgatagt taccggataa ggcgcagcgg tcgggctgaa
     1261 cggggggttc gtgcacacag cccagcttgg agcgaacgac ctacaccgaa ctgagatacc
     1321 tacagcgtga gctatgagaa agcgccacgc ttcccgaagg gagaaaggcg gacaggtatc
     1381 cggtaagcgg cagggtcgga acaggagagc gcacgaggga gcttccaggg ggaaacgcct
     1441 ggtatcttta tagtcctgtc gggtttcgcc acctctgact tgagcgtcga tttttgtgat
     1501 gctcgtcagg ggggcggagc ctatggaaaa acgccagcaa cgcggccttt ttacggttcc
     1561 tggccttttg ctggcctttt gctcacatgt tctttcctgc gttatcccct gattctgtgg
     1621 ataaccgtat taccgccttt gagtgagctg ataccgctcg ccgcagccga acgaccgagc
     1681 gcagcga
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart