pEVOL- pBpF

$160.00

  • Model: PVT10539
  • 50 Units in Stock
Ask a question


Add to Cart:

pEVOL-pBpF

Catalog No. PVT10539
Packing 2ug

 

pEVOL-pBpF Information
Function Other source plasmids
Resistance /
Screen /
Strain /
Culture temperature
Replicon
Copy
Promoter
Induction
Forward primer
Reverse primer

 

pEVOL-pBpF Sequence

LOCUS       Exported                6128 bp ds-DNA     circular SYN 27-SEP-2017
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    .
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 6128)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Sep 27, 2017  
FEATURES             Location/Qualifiers
     source          1..6128
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        22..306
                     /gene="araBAD"
                     /label=araBAD promoter
                     /note="promoter of the L-arabinose operon of E. coli; the 
                     araC regulatory gene is transcribed in the opposite 
                     direction (Guzman et al., 1995)"
     CDS             343..1263
                     /codon_start=1
                     /label=M.j. p-benzoylphenylalanine RS (2 copies +tRNA)
                     /translation="MDEFEMIKRNTSEIISEEELREVLKKDEKSAGIGFEPSGKIHLGH
                     YLQIKKMIDLQNAGFDIIILLADLHAYLNQKGELDEIRKIGDYNKKVFEAMGLKAKYLY
                     GSPFQLDKDYTLNVYRLALKTTLKRARRSMELIAREDENPKVAEVIYPIMQVNTSHYLG
                     VDVAVGGMEQRKIHMLARELLPKKVVCIHNPVLTGLDGEGKMSSSKGNFIAVDDSPEEI
                     RAKIKKAYCPAGVVEGNPIMEIAKYFLEYPLTIKRPEKFGGDLTVNSYEELESLFKNKE
                     LHPMDLKNAVAEELIKILEPIRKRL"
     CDS             complement(3266..3925)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /label=CmR
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(3926..4028)
                     /label=cat promoter
                     /note="promoter of the E. coli cat gene encoding 
                     chloramphenicol acetyltransferase"
     rep_origin      complement(4554..5099)
                     /direction=LEFT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             complement(5245..6123)
                     /codon_start=1
                     /gene="araC"
                     /product="L-arabinose regulatory protein"
                     /label=araC
                     /translation="MAEAQNDPLLPGYSFNAHLVAGLTPIEANGYLDFFIDRPLGMKGY
                     ILNLTIRGQGVVKNQGREFVCRPSDILLFPPGEIHHYGRHPEAREWYHQWVYFRPRAYW
                     HEWLNWPSIFANTGFFRPDEAHQPHFSDLFGQIINAGQGEGRYSELLAINLLEQLLLRR
                     MEAINESLHPPMDNRVREACQYISDHLADSNFDIASVAQHVCLSPSRLSHLFRQQLGIS
                     VLSWREDQRISQAKLLLSTTRMPIATVGRNVGFDDQLYFSRVFKKCTGASPSEFRAGCE
                     EKVNDVAVKLS"
ORIGIN
        1 tcatactccc gccattcaga gaagaaacca attgtccata ttgcatcaga cattgccgtc
       61 actgcgtctt ttactggctc ttctcgctaa ccaaaccggt aaccccgctt attaaaagca
      121 ttctgtaaca aagcgggacc aaagccatga caaaaacgcg taacaaaagt gtctataatc
      181 acggcagaaa agtccacatt gattatttgc acggcgtcac actttgctat gccatagcat
      241 ttttatccat aagattagcg gatcctacct gacgcttttt atcgcaactc tctactgttt
      301 ctccataccc gtttttttgg gctaacagga ggaattagat ctatggacga atttgaaatg
      361 ataaagagaa acacatctga aattatcagc gaggaagagt taagagaggt tttaaaaaaa
      421 gatgaaaaat ctgctggtat aggttttgaa ccaagtggta aaatacattt agggcattat
      481 ctccaaataa aaaagatgat tgatttacaa aatgctggat ttgatataat tatattgttg
      541 gctgatttac acgcctattt aaaccagaaa ggagagttgg atgagattag aaaaatagga
      601 gattataaca aaaaagtttt tgaagcaatg gggttaaagg caaaatatct ttatggaagt
      661 cctttccagc ttgataagga ttatacactg aatgtctata gattggcttt aaaaactacc
      721 ttaaaaagag caagaaggag tatggaactt atagcaagag aggatgaaaa tccaaaggtt
      781 gctgaagtta tctatccaat aatgcaggtt aatacgagtc attatctggg cgttgatgtt
      841 gcagttggag ggatggagca gagaaaaata cacatgttag caagggagct tttaccaaaa
      901 aaggttgttt gtattcacaa ccctgtctta acgggtttgg atggagaagg aaagatgagt
      961 tcttcaaaag ggaattttat agctgttgat gactctccag aagagattag ggctaagata
     1021 aagaaagcat actgcccagc tggagttgtt gaaggaaatc caataatgga gatagctaaa
     1081 tacttccttg aatatccttt aaccataaaa aggccagaaa aatttggtgg agatttgaca
     1141 gttaatagct atgaggagtt agagagttta tttaaaaata aggaattgca tccaatggat
     1201 ttaaaaaatg ctgtagctga agaacttata aagattttag agccaattag aaagagatta
     1261 taataagtcg accatcatca tcatcatcat tgagtttaaa cggtctccag cttggctgtt
     1321 ttggcggatg agagaagatt ttcagcctga tacagattaa atcagaacgc agaagcggtc
     1381 tgataaaaca gaatttgcct ggcggcagta gcgcggtggt cccacctgac cccatgccga
     1441 actcagaagt gaaacgccgt agcgccgatg gtagtgtggg gtctccccat gcgagagtag
     1501 ggaactgcca ggcatcaaat aaaacgaaag gctcagtcga aagactgggc cttgtttgtg
     1561 agctcccggt catcaatcat ccccataatc cttgttagat tatcaatttt aaaaaactaa
     1621 cagttgtcag cctgtcccgc tttaatatca tacgccgtta tacgttgttt acgctttgag
     1681 gaatcccata tggacgaatt tgaaatgata aagagaaaca catctgaaat tatcagcgag
     1741 gaagagttaa gagaggtttt aaaaaaagat gaaaaatctg ctggtatagg ttttgaacca
     1801 agtggtaaaa tacatttagg gcattatctc caaataaaaa agatgattga tttacaaaat
     1861 gctggatttg atataattat attgttggct gatttacacg cctatttaaa ccagaaagga
     1921 gagttggatg agattagaaa aataggagat tataacaaaa aagtttttga agcaatgggg
     1981 ttaaaggcaa aatatcttta tggaagtcct ttccagcttg ataaggatta tacactgaat
     2041 gtctatagat tggctttaaa aactacctta aaaagagcaa gaaggagtat ggaacttata
     2101 gcaagagagg atgaaaatcc aaaggttgct gaagttatct atccaataat gcaggttaat
     2161 acgagtcatt atctgggcgt tgatgttgca gttggaggga tggagcagag aaaaatacac
     2221 atgttagcaa gggagctttt accaaaaaag gttgtttgta ttcacaaccc tgtcttaacg
     2281 ggtttggatg gagaaggaaa gatgagttct tcaaaaggga attttatagc tgttgatgac
     2341 tctccagaag agattagggc taagataaag aaagcatact gcccagctgg agttgttgaa
     2401 ggaaatccaa taatggagat agctaaatac ttccttgaat atcctttaac cataaaaagg
     2461 ccagaaaaat ttggtggaga tttgacagtt aatagctatg aggagttaga gagtttattt
     2521 aaaaataagg aattgcatcc aatggattta aaaaatgctg tagctgaaga acttataaag
     2581 attttagagc caattagaaa gagattataa ctgcagtttc aaacgctaaa ttgcctgatg
     2641 cgctacgctt atcaggccta catgatctct gcaatatatt gagtttgcgt gcttttgtag
     2701 gccggataag gcgttcacgc cgcatccggc aagaaacagc aaacaatcca aaacgccgcg
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart