pEZZ18

$193.00

  • Model: PVT10668
  • 50 Units in Stock
Ask a question


Add to Cart:

pEZZ18

Catalog No. PVT10668
Packing 2ug

 

pEZZ18 Information

Plasmid Classification: E. coli Vector: Protein Expression Plasmid

Prokaryotic resistance: ampicillin Amp

Cloning strain: Escherichia coli DH5alpha

Culture conditions: LB medium, 37 C, aerobic


pEZZ18 Description
 

pEZZ18-vector

 

pEZZ18 Sequence
 

LOCUS       Exported                4591 bp ds-DNA     circular SYN 30-SEP-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pEZZ18

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 4591)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..4591

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     promoter        96..200

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             201..1061

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      1232..1820

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    2247..2431

                     /note="spa promoter"

     misc_feature    2432..2539

                     /note="protein A signal"

     CDS             2561..2731

                     /codon_start=1

                     /product="IgG-binding unit of Staphylococcus aureus protein

                     A"

                     /note="ProtA"

                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA

                     EAKKLNDAQAPK"

     CDS             2735..2905

                     /codon_start=1

                     /product="IgG-binding unit of Staphylococcus aureus protein

                     A"

                     /note="ProtA"

                     /translation="DNKFNKEQQNAFYEILHLPNLNEEQRNAFIQSLKDDPSQSANLLA

                     EAKKLNDAQAPK"

     misc_feature    2914..2970

                     /note="MCS"

                     /note="pUC18/19 multiple cloning site"

     rep_origin      3431..3944

                     /direction=RIGHT

                     /note="M13 ori"

                     /note="M13 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

ORIGIN

        1 gacgaaaggg cctcgtgata cgcctatttt tataggttaa tgtcatgata ataatggttt

       61 cttagacgtc aggtggcact tttcggggaa atgtgcgcgg aacccctatt tgtttatttt

      121 tctaaataca ttcaaatatg tatccgctca tgagacaata accctgataa atgcttcaat

      181 aatattgaaa aaggaagagt atgagtattc aacatttccg tgtcgccctt attccctttt

      241 ttgcggcatt ttgccttcct gtttttgctc acccagaaac gctggtgaaa gtaaaagatg

      301 ctgaagatca gttgggtgca cgagtgggtt acatcgaact ggatctcaac agcggtaaga

      361 tccttgagag ttttcgcccc gaagaacgtt ttccaatgat gagcactttt aaagttctgc

      421 tatgtggcgc ggtattatcc cgtattgacg ccgggcaaga gcaactcggt cgccgcatac

      481 actattctca gaatgacttg gttgagtact caccagtcac agaaaagcat cttacggatg

      541 gcatgacagt aagagaatta tgcagtgctg ccataaccat gagtgataac actgcggcca

      601 acttacttct gacaacgatc ggaggaccga aggagctaac cgcttttttg cacaacatgg

      661 gggatcatgt aactcgcctt gatcgttggg aaccggagct gaatgaagcc ataccaaacg

      721 acgagcgtga caccacgatg cctgtagcaa tggcaacaac gttgcgcaaa ctattaactg

      781 gcgaactact tactctagct tcccggcaac aattaataga ctggatggag gcggataaag

      841 ttgcaggacc acttctgcgc tcggcccttc cggctggctg gtttattgct gataaatctg

      901 gagccggtga gcgtgggtct cgcggtatca ttgcagcact ggggccagat ggtaagccct

      961 cccgtatcgt agttatctac acgacgggga gtcaggcaac tatggatgaa cgaaatagac

     1021 agatcgctga gataggtgcc tcactgatta agcattggta actgtcagac caagtttact

     1081 catatatact ttagattgat ttaaaacttc atttttaatt taaaaggatc taggtgaaga

     1141 tcctttttga taatctcatg accaaaatcc cttaacgtga gttttcgttc cactgagcgt

     1201 cagaccccgt agaaaagatc aaaggatctt cttgagatcc tttttttctg cgcgtaatct

     1261 gctgcttgca aacaaaaaaa ccaccgctac cagcggtggt ttgtttgccg gatcaagagc

     1321 taccaactct ttttccgaag gtaactggct tcagcagagc gcagatacca aatactgtcc

     1381 ttctagtgta gccgtagtta ggccaccact tcaagaactc tgtagcaccg cctacatacc

     1441 tcgctctgct aatcctgtta ccagtggctg ctgccagtgg cgataagtcg tgtcttaccg

     1501 ggttggactc aagacgatag ttaccggata aggcgcagcg gtcgggctga acggggggtt

     1561 cgtgcacaca gcccagcttg gagcgaacga cctacaccga actgagatac ctacagcgtg

     1621 agcattgaga aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

     1681 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

     1741 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

     1801 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1861 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1921 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1981 cagtgagcga ggaagcggaa gagcgcccaa tacgcaaacc gcctctcccc gcgcgttggc

     2041 cgattcatta atgcagctgg cacgacaggt ttcccgactg gaaagcgggc agtgagcgca

     2101 acgcaattaa tgtgagttag ctcactcatt aggcacccca ggctttacac tttatgcttc

     2161 cggctcgtat gttgtgtgga attgtgagcg gataacaatt tcacacagga aacagctatg

     2221 accatgatta cgaattagcg gccgctagcc gaaatagcgt gattttgcgg ttttaagcct

     2281 tttacttcct gaataaatct ttcagcaaaa tatttatttt ataagttgta aaacttacct

     2341 ttaaatttaa ttataaatat agattttagt attgcaatac ataattcgtt atattatgat

     2401 gactttacaa atacatacag ggggtattaa tttgaaaaag aaaaacattt attcaattcg

     2461 taaactaggt gtaggtattg catctgtaac tttaggtaca ttacttatat ctggtggcgt

     2521 aacacctgct gcaaatgctg cgcaacacga tgaagccgta gacaacaaat tcaacaaaga

     2581 acaacaaaac gcgttctatg agatcttaca tttacctaac ttaaacgaag aacaacgaaa

     2641 cgccttcatc caaagtttaa aagatgaccc aagccaaagc gctaaccttt tagcagaagc

     2701 taaaaagcta aatgatgctc aggcgccgaa agtagacaac aaattcaaca aagaacaaca

     2761 aaacgcgttc tatgagatct tacatttacc taacttaaac gaagaacaac gaaacgcctt

     2821 catccaaagt ttaaaagatg acccaagcca aagcgctaac cttttagcag aagctaaaaa

     2881 gctaaatgat gctcaggcgc cgaaagtaga cgcgaattcg agctcggtac ccggggatcc

     2941 tctagagtcg acctgcaggc atgcaagctt ggcactggcc gtcgttttac aacgtcgtga

     3001 ctgggaaaac cctggcgtta cccaacttaa tcgccttgca gcacatcccc ctttcgccag

     3061 ctggcgtaat agcgaagagg cccgcaccga tcgcccttcc caacagttgc gcagcctgaa

     3121 tggcgaatgg cgattccgtt gcaatggctg gcggtaatat tgttctggat attaccagca

     3181 aggccgatag tttgagttct tctactcagg caagtgatgt tattactaat caaagaagta

     3241 ttgcgacaac ggttaatttg cgtgatggac agactctttt actcggtggc ctcactgatt

     3301 ataaaaacac ttctcaggat tctggcgtac cgttcctgtc taaaatccct ttaatcggcc

     3361 tcctgtttag ctcccgctct gattctaacg aggaaagcac gttatacgtg ctcgtcaaag

     3421 caaccatagt acgcgccctg tagcggcgca ttaagcgcgg cgggtgtggt ggttacgcgc

     3481 agcgtgaccg ctacacttgc cagcgcccta gcgcccgctc ctttcgcttt cttcccttcc

     3541 tttctcgcca cgttcgccgg ctttccccgt caagctctaa atcgggggct ccctttaggg

     3601 ttccgattta gtgctttacg gcacctcgac cccaaaaaac ttgattaggg tgatggttca

     3661 cgtagtgggc catcgccctg atagacggtt tttcgccctt tgacgttgga gtccacgttc

     3721 tttaatagtg gactcttgtt ccaaactgga acaacactca accctatctc ggtctattct

     3781 tttgatttat aagggatttt gccgatttcg gcctattggt taaaaaatga gctgatttaa

     3841 caaaaattta acgcgaattt taacaaaata ttaacgttta caatttaaat atttgcttat

     3901 acaatcttcc tgtttttggg gcttttctga ttatcaaccg gggtacatat gattgacatg

     3961 ctagttttac gattaccgtt catcgattct cttgtttgct ccagactctc aggcaatgac

     4021 ctgatagcct ttgtagagac ctctcaaaaa tagctaccct ctccggcatg aatttatcag

     4081 ctagaacggt tgaatatcat attgatggtg atttgactgt ctccggcctt tctcacccgt

     4141 ttgaatcttt acctacacat tactcaggca ttgcatttaa aatatatgag ggttctaaaa

     4201 atttttatcc ttgcgttgaa ataaaggctt ctcccgcaaa agtattacag ggtcataatg

     4261 tttttggtac aaccgattta gctttatgct ctgaggcttt attgcttaat tttgctaatt

     4321 ctttgccttg cctgtatgat ttattggatg ttggaattga tgcggtattt tctccttacg

     4381 catctgtgcg gtatttcaca ccgcatatgg tgcactctca gtacaatctg ctctgatgcc

     4441 gcatagttaa gccagccccg acacccgcca acacccgctg acgcgccctg acgggcttgt

     4501 ctgctcccgg catccgctta cagacaagct gtgaccgtct ccgggagctg catgtgtcag

     4561 aggttttcac cgtcatcacc gaaacgcgcg a

//

 

*Caution

Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart