pG- Tf2 Plasmid

$136.00

  • Model: PVT0802
  • 50 Units in Stock
Ask a question


Add to Cart:

pG-Tf2

Search name

pG-Tf2,Plasmid pG-Tf2,pG-Tf2 vector

pG-Tf2 Plasmid Infomation

Plasmid classification: Escherichia coli vector; chaperone expression plasmid

Plasmid size: 8.3Kb

Prokaryotic resistance: chloramphenicol Chl

Screening markers: tetracycline Tet

Cloned strain: DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

Inducement: Arabia sugar

Remarks: plasmids of chaperone

pG-Tf2 Plasmid Sequence

LOCUS       Exported                8290 bp ds-DNA     circular SYN 13-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 2
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 8290)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Tuesday, September 13, 2016 from SnapGene Viewer 3.1.4
            
FEATURES             Location/Qualifiers
     source          1..8290
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     protein_bind    30..47
                     /gene="tetO"
                     /bound_moiety="tetracycline repressor TetR"
                     /note="tet operator"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     RBS             98..109
                     /note="strong bacterial ribosome binding site (Elowitz and
                     Leibler, 2000)"
     CDS             206..259
                     /codon_start=1
                     /product="GroES chaperone mobile loop that interacts with
                     GroEL"
                     /note="S loop"
                     /translation="EVETKSAGGIVLTGSAAA"
     terminator      4387..4473
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB
                     gene"
     promoter        4533..4588
                     /gene="tetR"
                     /note="tetR/tetA promoters"
                     /note="overlapping promoters for bacterial tetR and tetA"
     protein_bind    4534..4552
                     /gene="tetO"
                     /bound_moiety="tetracycline repressor TetR"
                     /note="tet operator"
                     /note="bacterial operator O2 for the tetR and tetA genes"
     protein_bind    4564..4582
                     /bound_moiety="tetracycline repressor TetR"
                     /note="tet operator"
                     /note="bacterial operator O1 for the tetR and tetA genes"
     CDS             4607..5230
                     /codon_start=1
                     /gene="tetR from transposon Tn10"
                     /product="tetracycline repressor TetR"
                     /note="TetR"
                     /note="TetR binds to the tetracycline operator tetO to
                     inhibit transcription. This inhibition can be relieved by
                     adding tetracycline or doxycycline."
                     /translation="MSRLDKSKVINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHV
                     KNKRALLDALAIEMLDRHHTHFCPLEGESWQDFLRNNAKSFRCALLSHRDGAKVHLGTR
                     PTEKQYETLENQLAFLCQQGFSLENALYALSAVGHFTLGCVLEDQEHQVAKEERETPTT
                     DSMPPLLRQAIELFDHQGAEPAFLFGLELIICGLEKQLKCESGS"
     CDS             complement(6245..6904)
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
     promoter        complement(6905..7007)
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     rep_origin      complement(7533..8077)
                     /direction=LEFT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
ORIGIN
        1 ctcgagaaat cataaaaaat ttatttgctt ccctatcagt gatagagtat aatagagtcg
       61 aattgttagc ggagaagaat ttcacacaga attcattaaa gaggagaaag tcgaggcgtc
      121 acccataaca gatacggact ttctcaaagg agagttatca atgaatattc gtccattgca
      181 tgatcgcgtg atcgtcaagc gtaaagaagt tgaaactaaa tctgctggcg gcatcgttct
      241 gaccggctct gcagcggcta aatccacccg cggcgaagtg ctggctgtcg gcaatggccg
      301 tatccttgaa aatggcgaag tgaagccgct ggatgtgaaa gttggcgaca tcgttatttt
      361 caacgatggc tacggtgtga aatctgagaa gatcgacaat gaagaagtgt tgatcatgtc
      421 cgaaagcgac attctggcaa ttgttgaagc gtaatccgcg cacgacactg aacatacgaa
      481 tttaaggaat aaagataatg gcagctaaag acgtaaaatt cggtaacgac gctcgtgtga
      541 aaatgctgcg cggcgtaaac gtactggcag atgcagtgaa agttaccctc ggtccaaaag
      601 gccgtaacgt agttctggat aaatctttcg gtgcaccgac catcaccaaa gatggtgttt
      661 ccgttgctcg tgaaatcgaa ctggaagaca agttcgaaaa tatgggtgcg cagatggtga
      721 aagaagttgc ctctaaagca aacgacgctg caggcgacgg taccaccact gcaaccgtac
      781 tggctcaggc tatcatcact gaaggtctga aagctgttgc tgcgggcatg aacccgatgg
      841 acctgaaacg tggtatcgac aaagcggtta ccgctgcagt tgaagaactg aaagcgctgt
      901 ccgtaccatg ctctgactct aaagcgattg ctcaggttgg taccatctcc gctaactccg
      961 acgaaaccgt aggtaaactg atcgctgaag cgatggacaa agtcggtaaa gaaggcgtta
     1021 tcaccgttga agacggtacc ggtctgcagg acgaactgga cgtggttgaa ggtatgcagt
     1081 tcgaccgtgg ctacctgtct ccttacttca tcaacaagcc ggaaactggc gcagtagaac
     1141 tggaaagccc gttcatcctg ctggctgaca agaaaatctc caacatccgc gaaatgctgc

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart