pGEN- MCS

$260.00

  • Model: PVT10565
  • 50 Units in Stock
Ask a question


Add to Cart:

pGEN-MCS

PVT10565  Packing 2ug

 

pGEN-MCS Informaiton

Replicon: p15A ori

Terminator: rrnB T1 Terminator

Plasmid classification: Escherichia coli vector; cloning plasmid

Plasmid size: 5160bp

Resistance: ampicillin Amp

Clonal strain: DH5 alpha

Culture conditions: 37 C, aerobic, LB

Expression host: BL21 (DE3)

Culture conditions: 37 C, aerobic, LB

Function E.coli Cloning plasmid

 

pGEN-MCS Description

PGEN-MCS is a low-copy plasmid, 5160 BP in size, containing an Amp penicillin-resistant gene with a replicon of P15A ori.

 

pGEN-MCS Cloning site

pGEN-MCS-vector

 

pGEN-MCS Sequence

LOCUS       Exported                5160 bp ds-DNA     circular SYN 13-十月-2016

DEFINITION  synthetic circular DNA
KEYWORDS    pGEN-MCS
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5160)
  TITLE     Direct Submission
            
FEATURES             Location/Qualifiers
     source          1..5160
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     rep_origin      complement(283..828)
                     /direction=LEFT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     terminator      903..930
                     /note="rrnB T2 terminator"
                     /note="transcription terminator T2 from the E. coli rrnB 
                     gene"
     terminator      1022..1108
                     /gene="Escherichia coli rrnB"
                     /note="rrnB T1 terminator"
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     CDS             complement(1823..2683)
                     /codon_start=1
                     /gene="bla"
                     /product="beta-lactamase"
                     /note="AmpR"
                     /note="confers resistance to ampicillin, carbenicillin, and
                     related antibiotics"
                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI
                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS
                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW
                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA
                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS
                     LIKHW"
     promoter        complement(2684..2788)
                     /gene="bla"
                     /note="AmpR promoter"
ORIGIN
        1 gaattcctgc agggcatgcc ccgggcatat gaagcttggt accgggatcc gcggccgcgg
       61 gccccatgga tcgatagctg gtcgacacaa tctgcccttt cgaaagatcc caacgaaaag
      121 cgtgaccaca tggtccttct tgagtttgta actgctgctg ggattacaca tggcatggat
      181 gagctctaca aataatgagc tagcccgcct aatgagcggg cttttttttc tcggcctagg
      241 agatacttaa cagggaagtg agagggccgc ggcaaagccg tttttccata ggctccgccc
      301 ccctgacaag catcacgaaa tctgacgctc aaatcagtgg tggcgaaacc cgacaggact
      361 ataaagatac caggcgtttc cccctggcgg ctccctcgtg cgctctcctg ttcctgcctt
      421 tcggtttacc ggtgtcattc cgctgttatg gccgcgtttg tctcattcca cgcctgacac
      481 tcagttccgg gtaggcagtt cgctccaagc tggactgtat gcacgaaccc cccgttcagt
      541 ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggaa agacatgcaa
      601 aagcaccact ggcagcagcc actggtaatt gatttagagg agttagtctt gaagtcatgc
      661 gccggttaag gctaaactga aaggacaagt tttggtgact gcgctcctcc aagccagtta
      721 cctcggttca aagagttggt agctcagaga accttcgaaa aaccgccctg caaggcggtt
      781 ttttcgtttt cagagcaaga gattacgcgc agaccaaaac gatctcaaga agatcatctt
      841 attaatcaga taaaatattt ctaggatcta aaacactagg cccaagagtt tgtagaaacg
      901 caaaaaggcc atccgtcagg atggccttct gcttaatttg atgcctggca gtttatggcg
      961 ggcgtcctgc ccgccaccct ccgggccgtt gcttcgcaac gttcaaatcc gctcccggcg
     1021 gatttgtcct actcaggaga gcgttcaccg acaaacaaca gataaaacga aaggcccagt
     1081 ctttcgactg agcctttcgt tttatttgat gcctggcagt tccctactct cgcatgggga
     1141 gaccccacac taccatcggc gctacggcgt ttcacttctg agttcggcat ggggtcaggt
     1201 gggaccaccg cgctactgcc gccaggcaaa ttctgtttta tcagaccgct tctgcgttct
     1261 gatttaatct gtatcaggct gaaaatcttc tctcatccgc caaaacagcc aagctggatc
     1321 tggcaaatcg ctgaatattc cttttgtctc cgaccatcag gcacctgagt cgctgtcttt
     1381 ttcgtgacat tcagttcgct gcgctcacgg ctctggcagt gaatgggggt aaatggcact
     1441 acaggcgcct tttatggatt catgcaagga aactacccat aatacaagaa aagcccgtca
     1501 cgggcttctc agggcgtttt atggcgggtc tgctatgtgg tgctatctga ctttttgctg
     1561 ttcagcagtt cctgccctct gattttccag tctgaccact tcggattatc ccgtgacagg
     1621 tcattcagac tggctaatgc acccagtaag gcagcggtat catcaacagg cttacccgtc
     1681 ttactgtcaa ccggatctaa aacactagtt aagggatttt ggtcatgaga ttatcaaaaa
     1741 ggatcttcac ctagatcctt ttaaattaaa aatgaagttt taaatcaatc taaagtatat
     1801 atgagtaaac ttggtctgac agttaccaat gcttaatcag tgaggcacct atctcagcga
     1861 tctgtctatt tcgttcatcc atagttgcct gactccccgt cgtgtagata actacgatac
     1921 gggagggctt accatctggc cccagtgctg caatgatacc gcgagaccca cgctcaccgg
     1981 ctccagattt atcagcaata aaccagccag ccggaagggc cgagcgcaga agtggtcctg
     2041 caactttatc cgcctccatc cagtctatta attgttgccg ggaagctaga gtaagtagtt
     2101 cgccagttaa tagtttgcgc aacgttgttg ccattgctac aggcatcgtg gtgtcacgct
     2161 cgtcgtttgg tatggcttca ttcagctccg gttcccaacg atcaaggcga gttacatgat
     2221 cccccatgtt gtgcaaaaaa gcggttagct ccttcggtcc tccgatcgtt gtcagaagta
     2281 agttggccgc agtgttatca ctcatggtta tggcagcact gcataattct cttactgtca
     2341 tgccatccgt aagatgcttt tctgtgactg gtgagtactc aaccaagtca ttctgagaat
     2401 agtgtatgcg gcgaccgagt tgctcttgcc cggcgtcaac acgggataat accgcgccac
     2461 atagcagaac tttaaaagtg ctcatcattg gaaaacgttc ttcggggcga aaactctcaa
     2521 ggatcttacc gctgttgaga tccagttcga tgtaacccac tcgtgcaccc aactgatctt
     2581 cagcatcttt tactttcacc agcgtttctg ggtgagcaaa aacaggaagg caaaatgccg
     2641 caaaaaaggg aataagggcg acacggaaat gttgaatact catactcttc ctttttcaat
     2701 attattgaag catttatcag ggttattgtc tcatgagcgg atacatattt gaatgtattt
     2761 agaaaaataa acaaataggg gttccgcgca catttccccg aaaagtgcca cctgacgtct
     2821 aagaaaccat tattatcatg acattaacct ataaaaatag gcgtatcacg aggccctttc
     2881 gtcttctaga caacatcagc aaggagaaag gggctaccgg cgaaccagca gcccctttat
     2941 aaaggcgctt cagtagtcag accagcatca gtcctgaaaa ggcgggcctg cgcccgcctc
     3001 caggttgcta cttaccggat tcgtaagcca tgaaagccgc cacctccctg tgtccgtctc
     3061 tgtaacgaat ctcgcacagc gattttcgtg tcagataagt gaatatcaac agtgtgagac
     3121 acacgatcaa cacacaccag acaagggaac ttcgtggtag tttcatggcc ttcttctcct
     3181 tgcgcaaagc gcggtaagag gctatcctga tgtggactag acatagggat gcctcgtggt
     3241 ggttaatgaa aattaactta ctacggggct atcttctttc tgccacacaa cacggcaaca
     3301 aaccaccttc acgtcatgag gcagaaagcc tcaagcgccg ggcacatcat agcccatata
     3361 cctgcacgct gaccacactc actttccctg aaaataatcc gctcattcag accgttcacg
     3421 ggaaatccgt gtgattgttg ccgcatcacg ctgcctcccg gagtttgtct cgagcacttt
     3481 tgttacccgc caaacaaaac ccaaaaacaa cccataccca acccaataaa acaccaaaac
     3541 aagacaaata atcattgatt gatggttgaa atggggtaaa cttgacaaac aaacccactt
     3601 aaaacccaaa acatacccaa acacacacca aaaaaacacc ataaggagtt ttataaatgt
     3661 tggtattcat tgatgacggt tcaacaaaca tcaaactaca gtggcaggaa agcgacggaa
     3721 caattaaaca gcacattagc ccgaacagct tcaaacgcga gtgggcagtc tcttttggtg
&
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart