pG+HOST9

$260.00

  • Model: PVT11382
  • 50 Units in Stock
Ask a question


Add to Cart:

pG+HOST9

Catalog No. PVT11382
Packing 2ug

 

pG+HOST9 Information

Replicon: repA

Plasmid classification: other host plasmids; other series of plasmids.

Plasmid size: 3752bp

Prokaryotic resistance: erythromycin Erm

Culture conditions: 30 degrees centigrade

 

 

pG+HOST9 Description

PG+HOST9  is a thermosensitive integrated carrier of lactic acid bacteria and other gram positive bacteria.

pG+HOST9-vector

 

 

pG+HOST9 Sequence

LOCUS       Exported                3752 bp ds-DNA     circular SYN 21-SEP-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3752)
  TITLE     Direct Submission
  JOURNAL   Exported Sep 21, 2017  
FEATURES             Location/Qualifiers
     source          1..3752
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(151..888)
                     /codon_start=1
                     /label=Erm
                     /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT
                     KLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYH
                     LSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH
                     PKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNN
                     LSTVTYEQVLSIFNSYLLFNGRK"
     CDS             2216..2914
                     /codon_start=1
                     /label=repA
                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE
                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD
                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV
                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK
                     VLDAETGEIK"
     promoter        3647..3665
                     /label=T7 promoter
                     /note="promoter for bacteriophage T7 RNA polymerase"
     misc_feature    3674..3751
                     /label=MCS
ORIGIN
        1 ctagagcggc cgccaccgcg gtgggatcct ctagagtccg ctagggacct ctttagctcc
       61 ttggaagctg tcagtagtat acctaataat ttatctacat tccctttagt aacgtgtaac
      121 tttccaaatt tacaaaagcg actcatagaa ttatttcctc ccgttaaata atagataact
      181 attaaaaata gacaatactt gctcataagt aacggtactt aaattgttta ctttggcgtg
      241 tttcattgct tgatgaaact gatttttagt aaacagttga cgatattctc gattgaccca
      301 ttttgaaaca aagtacgtat atagcttcca atatttatct ggaacatctg tggtatggcg
      361 ggtaagtttt attaagacac tgtttacttt tggtttagga tgaaagcatt ccgctggcag
      421 cttaagcaat tgctgaatcg agacttgagt gtgcaagagc aaccctagtg ttcggtgaat
      481 atccaaggta cgcttgtaga atccttcttc aacaatcaga tagatgtcag acgcatggct
      541 ttcaaaaacc acttttttaa taatttgtgt gcttaaatgg taaggaatac tcccaacaat
      601 tttatacctc tgtttgttag ggaattgaaa ctgtagaata tcttggtgaa ttaaagtgac
      661 acgagtattc agttttaatt tttctgacga taagttgaat agatgactgt ctaattcaat
      721 agacgttacc tgtttactta ttttagccag tttcgtcgtt aaatgccctt tacctgttcc
      781 aatttcgtaa acggtatcgg tttcttttaa attcaattgt tttattattt ggttgagtac
      841 tttttcactc gttaaaaagt tttgagaata ttttatattt ttgttcatgt aatcactcct
      901 tcttaattac aaatttttag catctaattt aacttcaatt cctattatac aaaattttaa
      961 gatactgcac tatcaacaca ctcttaagtt tgcttctaag tcttatttcc ataacttctt
     1021 ttacgtttcc gccattcttt gctgtttcga tttttatgat atggtgcaag tcagcacgaa
     1081 cacgaaccgt cttatctccc attatatctt tttttgcact gattggtgta tcatttcgtt
     1141 tttcttttgc gcgactctag aggatcctga taaatatgaa catgatgagt gatcgttaaa
     1201 tttatactgc aatcggatgc gattattgaa taaaagatat gagagattta tctaatttct
     1261 tttttcttgt aaaaaaagaa agttcttaaa ggttttatag ttttggtcgt agagcacacg
     1321 gtttaacgac ttaattacga agtaaataag tctagtgtgt tagactttat gaaatctata
     1381 tacgtttata tatatttatt atccgatttt ttattaaaac gtctcaaaat cgtttctgag
     1441 acgttttagc gtttatttcg tttagttatc ggcataatcg ttaaaacagg cgttatcgta
     1501 gcgtaaaagc ccttgagcgt agcgtggctt tgcagcgaag atgttgtctg ttagattatg
     1561 aaagccgatg actgaatgaa ataataagcg cagcgccctt ctatttcggt tggaggaggc
     1621 tcaagggagt atgagggaat gaaattccct catgggtttg attttaaaaa ttgcttgcaa
     1681 ttttgccgag cggtagcgct ggaaaatttt tgaaaaaaat ttggaatttg gaaaaaaatg
     1741 gggggaaagg aagcgaattt tgcttccgta ctacgacccc ccattaagtg ccgagtgcca
     1801 atttttgtgc caaaaacgct ctatcccaac tggctcaagg gtttaagggg tttttcaatc
     1861 gccaacgaat cgccaacgtt ttcgccaacg ttttttataa atctatattt aagtagcttt
     1921 attgttgttt ttatgattac aaagtgatac actaacttta taaaattatt tgattggagt
     1981 tttttaaatg gtgatttcag aatcgaaaaa aagagttatg atttctctga caaaagagca
     2041 agataaaaaa ttaacagata tggcgaaaca aaaaggtttt tcaaaatctg cggttgcggc
     2101 gttagctata gaagaatatg caagaaagga atcagaacaa aaaaaataag cgaaagctcg
     2161 cgtttttaga aggatacgag ttttcgctac ttgtttttga taaggtaatt atatcatggc
     2221 tattaaaaat actaaagcta gaaattttgg atttttatta tatcctgact caattcctaa
     2281 tgattggaaa gaaaaattag agagtttggg cgtatctatg gctgtcagtc ctttacacga
     2341 tatggacgaa aaaaaagata aagatacatg gaataatagt aatattatac aaaatggaaa
     2401 gcactataaa aaaccacact atcacgttat atatattgca cgaaatcctg taacaataga
     2461 aagcgttagg aacaagatta agcgaaaatt ggggaatagt tcagttgctc atgttgagat
     2521 acttgattat atcaaaggtt catatgaata tttgactcat gaatcaaagg acgctattgc
     2581 taagaataaa catatatacg acaaaaaaga tattttgaac attaatgatt ttgatattga
     2641 ccgctatata acacttgatg aaagccaaaa aagagaattg aagaatttac ttttagatat
     2701 agtggatgac tataatttgg taaatacaaa agatttaatg gcttttattc gccttagggg
     2761 agcggagttt ggaattttaa atacgaatga tgtaaaagat attgtttcaa caaactctag
     2821 cgcctttaga ttatggtttg agggcaatta tcagtgtgga tatagagcaa gttatgcaaa
     2881 ggttcttgat gctgaaacgg gggaaataaa atgacaaaca aagaaaaaga gttatttgct
     2941 gaaaatgagg aattaaaaaa agaaattaag gacttaaaag agcgtattga aagatacaga
     3001 gaaatggaag ttgaattaag tacaacaata gatttattga gaggagggat tattgaataa
     3061 ataaaagccc cctgacgaaa gtcgaagggg gtttttattt tggtttgatg ttgcgattaa
     3121 tagcaataca attgcaataa acaaaatgat cttccttcag gttatgacca tctgtgccag
     3181 ttcgtaatgt ctggtcaact ttccgactct gagaaacttc tggaatcgct agagaatttc
     3241 tggaatggga ttcaggagtg gacagaacga cacggatata tagtggatgt gtcaaaacgc
     3301 ataccatttt gaacgatgac ctctaataat tgttaatcat gttggttacg tatttattaa
     3361 cttctcctag tattagtaat tatcatggct gtcatggcgc attaacggaa taaagggtgt
     3421 gcttaaatcg ggccattttg cgtaataaga aaaaggatta attatgagcg aattgaatta
     3481 ataataaggt aatagattta cattagaaaa tgaaagggga ttttatgcgt gagaatgtta
     3541 cagtctatcc ctggcgaaag ggggatgtgc tgcaaggcga ttaagttggg taacgccagg
     3601 gttttcccag tcacgacgtt gtaaaacgac ggccagtgag cgcgcgtaat acgactcact
     3661 atagggcgaa ttgggtaccg ggccccccct cgaggtcgac ggtatcgata agcttgatat
     3721 cgaattcctg cagcccgggg gatccactag tt
//
 
Caution:
Product is for research use only!
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart