pG+HOST9

$260.00

  • Model: PVT11382
  • 49 Units in Stock
Ask a question


Add to Cart:

pG+HOST9

Catalog No. PVT11382
Packing 2ug

 

pG+HOST9 Information

Replicon: repA

Plasmid classification: other host plasmids; other series of plasmids.

Plasmid size: 3752bp

Clone strain: DH5 alpha

Prokaryotic resistance: erythromycin Erm 200 μg/ml

Culture conditions: 30 degrees centigrade

 

 

pG+HOST9 Description

PG+HOST9  is a thermosensitive integrated carrier of lactic acid bacteria and other gram positive bacteria.

pG+HOST9-vector

 

 

pG+HOST9 Sequence

LOCUS       Exported                3752 bp ds-DNA     circular SYN 21-SEP-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 3752)

  TITLE     Direct Submission

  JOURNAL   Exported Sep 21, 2017

FEATURES             Location/Qualifiers

     source          1..3752

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(151..888)

                     /codon_start=1

                     /label=Erm

                     /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT

                     KLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYH

                     LSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH

                     PKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNN

                     LSTVTYEQVLSIFNSYLLFNGRK"

     CDS             2216..2914

                     /codon_start=1

                     /label=repA

                     /translation="MAIKNTKARNFGFLLYPDSIPNDWKEKLESLGVSMAVSPLHDMDE

                     KKDKDTWNNSNIIQNGKHYKKPHYHVIYIARNPVTIESVRNKIKRKLGNSSVAHVEILD

                     YIKGSYEYLTHESKDAIAKNKHIYDKKDILNINDFDIDRYITLDESQKRELKNLLLDIV

                     DDYNLVNTKDLMAFIRLRGAEFGILNTNDVKDIVSTNSSAFRLWFEGNYQCGYRASYAK

                     VLDAETGEIK"

     promoter        3647..3665

                     /label=T7 promoter

                     /note="promoter for bacteriophage T7 RNA polymerase"

     misc_feature    3674..3751

                     /label=MCS

ORIGIN

        1 ctagagcggc cgccaccgcg gtgggatcct ctagagtccg ctagggacct ctttagctcc

       61 ttggaagctg tcagtagtat acctaataat ttatctacat tccctttagt aacgtgtaac

      121 tttccaaatt tacaaaagcg actcatagaa ttatttcctc ccgttaaata atagataact

      181 attaaaaata gacaatactt gctcataagt aacggtactt aaattgttta ctttggcgtg

      241 tttcattgct tgatgaaact gatttttagt aaacagttga cgatattctc gattgaccca

      301 ttttgaaaca aagtacgtat atagcttcca atatttatct ggaacatctg tggtatggcg

      361 ggtaagtttt attaagacac tgtttacttt tggtttagga tgaaagcatt ccgctggcag

      421 cttaagcaat tgctgaatcg agacttgagt gtgcaagagc aaccctagtg ttcggtgaat

      481 atccaaggta cgcttgtaga atccttcttc aacaatcaga tagatgtcag acgcatggct

      541 ttcaaaaacc acttttttaa taatttgtgt gcttaaatgg taaggaatac tcccaacaat

      601 tttatacctc tgtttgttag ggaattgaaa ctgtagaata tcttggtgaa ttaaagtgac

      661 acgagtattc agttttaatt tttctgacga taagttgaat agatgactgt ctaattcaat

      721 agacgttacc tgtttactta ttttagccag tttcgtcgtt aaatgccctt tacctgttcc

      781 aatttcgtaa acggtatcgg tttcttttaa attcaattgt tttattattt ggttgagtac

      841 tttttcactc gttaaaaagt tttgagaata ttttatattt ttgttcatgt aatcactcct

      901 tcttaattac aaatttttag catctaattt aacttcaatt cctattatac aaaattttaa

      961 gatactgcac tatcaacaca ctcttaagtt tgcttctaag tcttatttcc ataacttctt

     1021 ttacgtttcc gccattcttt gctgtttcga tttttatgat atggtgcaag tcagcacgaa

     1081 cacgaaccgt cttatctccc attatatctt tttttgcact gattggtgta tcatttcgtt

     1141 tttcttttgc gcgactctag aggatcctga taaatatgaa catgatgagt gatcgttaaa

     1201 tttatactgc aatcggatgc gattattgaa taaaagatat gagagattta tctaatttct

     1261 tttttcttgt aaaaaaagaa agttcttaaa ggttttatag ttttggtcgt agagcacacg

     1321 gtttaacgac ttaattacga agtaaataag tctagtgtgt tagactttat gaaatctata

     1381 tacgtttata tatatttatt atccgatttt ttattaaaac gtctcaaaat cgtttctgag

     1441 acgttttagc gtttatttcg tttagttatc ggcataatcg ttaaaacagg cgttatcgta

     1501 gcgtaaaagc ccttgagcgt agcgtggctt tgcagcgaag atgttgtctg ttagattatg

     1561 aaagccgatg actgaatgaa ataataagcg cagcgccctt ctatttcggt tggaggaggc

     1621 tcaagggagt atgagggaat gaaattccct catgggtttg attttaaaaa ttgcttgcaa

     1681 ttttgccgag cggtagcgct ggaaaatttt tgaaaaaaat ttggaatttg gaaaaaaatg

     1741 gggggaaagg aagcgaattt tgcttccgta ctacgacccc ccattaagtg ccgagtgcca

     1801 atttttgtgc caaaaacgct ctatcccaac tggctcaagg gtttaagggg tttttcaatc

     1861 gccaacgaat cgccaacgtt ttcgccaacg ttttttataa atctatattt aagtagcttt

     1921 attgttgttt ttatgattac aaagtgatac actaacttta taaaattatt tgattggagt

     1981 tttttaaatg gtgatttcag aatcgaaaaa aagagttatg atttctctga caaaagagca

     2041 agataaaaaa ttaacagata tggcgaaaca aaaaggtttt tcaaaatctg cggttgcggc

     2101 gttagctata gaagaatatg caagaaagga atcagaacaa aaaaaataag cgaaagctcg

     2161 cgtttttaga aggatacgag ttttcgctac ttgtttttga taaggtaatt atatcatggc

     2221 tattaaaaat actaaagcta gaaattttgg atttttatta tatcctgact caattcctaa

     2281 tgattggaaa gaaaaattag agagtttggg cgtatctatg gctgtcagtc ctttacacga

     2341 tatggacgaa aaaaaagata aagatacatg gaataatagt aatattatac aaaatggaaa

     2401 gcactataaa aaaccacact atcacgttat atatattgca cgaaatcctg taacaataga

     2461 aagcgttagg aacaagatta agcgaaaatt ggggaatagt tcagttgctc atgttgagat

     2521 acttgattat atcaaaggtt catatgaata tttgactcat gaatcaaagg acgctattgc

     2581 taagaataaa catatatacg acaaaaaaga tattttgaac attaatgatt ttgatattga

     2641 ccgctatata acacttgatg aaagccaaaa aagagaattg aagaatttac ttttagatat

     2701 agtggatgac tataatttgg taaatacaaa agatttaatg gcttttattc gccttagggg

     2761 agcggagttt ggaattttaa atacgaatga tgtaaaagat attgtttcaa caaactctag

     2821 cgcctttaga ttatggtttg agggcaatta tcagtgtgga tatagagcaa gttatgcaaa

     2881 ggttcttgat gctgaaacgg gggaaataaa atgacaaaca aagaaaaaga gttatttgct

     2941 gaaaatgagg aattaaaaaa agaaattaag gacttaaaag agcgtattga aagatacaga

     3001 gaaatggaag ttgaattaag tacaacaata gatttattga gaggagggat tattgaataa

     3061 ataaaagccc cctgacgaaa gtcgaagggg gtttttattt tggtttgatg ttgcgattaa

     3121 tagcaataca attgcaataa acaaaatgat cttccttcag gttatgacca tctgtgccag

     3181 ttcgtaatgt ctggtcaact ttccgactct gagaaacttc tggaatcgct agagaatttc

     3241 tggaatggga ttcaggagtg gacagaacga cacggatata tagtggatgt gtcaaaacgc

     3301 ataccatttt gaacgatgac ctctaataat tgttaatcat gttggttacg tatttattaa

     3361 cttctcctag tattagtaat tatcatggct gtcatggcgc attaacggaa taaagggtgt

     3421 gcttaaatcg ggccattttg cgtaataaga aaaaggatta attatgagcg aattgaatta

     3481 ataataaggt aatagattta cattagaaaa tgaaagggga ttttatgcgt gagaatgtta

     3541 cagtctatcc ctggcgaaag ggggatgtgc tgcaaggcga ttaagttggg taacgccagg

     3601 gttttcccag tcacgacgtt gtaaaacgac ggccagtgag cgcgcgtaat acgactcact

     3661 atagggcgaa ttgggtaccg ggccccccct cgaggtcgac ggtatcgata agcttgatat

     3721 cgaattcctg cagcccgggg gatccactag tt

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart