pGM1190

$260.00

  • Model: PVT11375
  • 50 Units in Stock
Ask a question


Add to Cart:

pGM1190

Catalog No. PVT11375
Packing 2ug

 

pGM1190 Information

Promoter: TipA promoter

Plasmid size: 7089bp

Plasmid tagging: N-6xHis/thrombin site/T7 tag, C-6xHis

Prokaryotic resistance: anpromycin Apr

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: aerobic, LB, 37 centigrade

Expression host: Streptomyces

 

pGM1190 Description

PGM1190 is a Streptomyces expression vector, which drives the expression of target genes through TipA promoter. When it is converted to streptomycin, it should be cultured at 35 degrees Celsius.OriT containing mobilizable vector for thiostrepton induced gene expression in Streptomyces,replicates also in Streptomyces (below 35°C).

pGM1190

 

PGM1190 Sequence

LOCUS       Exported                7089 bp ds-DNA     circular SYN 22-OCT-2017
DEFINITION  synthetic circular DNA
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 7089)
  TITLE     Direct Submission
             
FEATURES             Location/Qualifiers
     source          1..7089
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     oriT            467..576
                     /note="incP origin of transfer"
     CDS             892..1692
                     /codon_start=1
                     /gene="aac(3)IV"
                     /product="aminoglycoside 3-N-acetyltransferase type IV     
                               "
                     /label=Apr
                     /note="confers resistance to apramycin (Paget and Davies, 
                     1996)"
                     /translation="MSSAVECNVVQYEWRKAELIGQLLNLGVTPGGVLLVHSSFRSVRP
                     LEDGPLGLIEALRAALGPGGTLVMPSWSGLDDEPFDPATSPVTPDLGVVSDTFWRLPNV
                     KRSAHPFAFAAAGPQAEQIISDPLPLPPHSPASPVARVHELDGQVLLLGVGHDANTTLH
                     LAELMAKVPYGVPRHCTILQDGKLVRVDYLENDHCCERFALADRWLKEKSLQKEGPVGH
                     AFARLIRSRDIVATALGQLGRDPLIFLHPPEAGCEECDAARQSIG"
     rep_origin      1994..2582
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     terminator      3163..3197
                     /label=lambda t0 term
                     /note="minimal transcription terminator from phage lambda 
                     (Scholtissek and Grosse, 1987)"
     misc_feature    3232..3332
                     /label=TipA promoter
     misc_feature    3347..3357
                     /label=RBS
     CDS             3376..3393
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     CDS             3403..3420
                     /codon_start=1
                     /product="thrombin recognition and cleavage site"
                     /label=thrombin site
                     /translation="LVPRGS"
     CDS             3424..3456
                     /codon_start=1
                     /product="leader peptide from bacteriophage T7 gene 10"
                     /label=T7 tag
                     /note="promotes efficient translation in E. coli"
                     /translation="MASMTGGQQMG"
     CDS             3506..3523
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /label=6xHis
                     /translation="HHHHHH"
     terminator      3688..3736
                     /label=fd terminator
                     /note="central terminator from bacteriophage fd (Otsuka and
                     Kunisawa, 1982)"
     CDS             4079..4888
                     /codon_start=1
                     /label=tsr
                     /note="Thiostrepton resistance protein"
                     /translation="MTELDTIANPSDPAVQRIIDVTKPSRSNIKTTLIEDVEPLMHSIA
                     AGVEFIEVYGSDSSPFPSELLDLCGRQNIPVRLIDSSIVNQLFKGERKAKTFGIARVPR
                     PARFGDIASRRGDVVVLDGVKIVGNIGAIVRTSLALGASGIILVDSDITSIADRRLQRA
                     SRGYVFSLPVVLSGREEAIAFIRDSGMQLMTLKADGDISVKELGDNPDRLALLFGSEKG
                     GPSDLFEEASSASVSIPMMSQTESLNVSVSLGIALHERIDRNLAANR"
     CDS             5451..6893
                     /codon_start=1
                     /gene="rep"
                     /product="replication initiator protein from the 
                     Streptomyces ghanaensis plasmid pSG5"
                     /label=pSG5 Rep
                     /translation="MWKPGEATWGNTCRCNNVHTCPWCMSRILAVRGSNVQLAADGLAD
                     AGYGLHLGTNTLRHFERMAFGTVRKGMRHGLVAVLHDGWKGAYGSSGRRWRTMRDDFGI
                     IGYERAFEDTFGWGSGWHLHWHTLWVTREVLGPDAQAAFRDALAGAWAAGVESAGGYTV
                     SETCDRPGCSCEGKGHGTDVRPLNGADAADGDAGKQARYLYKDGDKTKGGVAKIGLELA
                     GQNFKAGRGDDRMGPLDLGDAAAAELQRLRRPGPFVEKYREREFGVFQVRKHYRSQNLN
                     RLIKELGIQQDVRTEEEITDDTEGLVAIAVIPAYIWYRYIARVAGRRLDLIKVAETYGL
                     PGVRRLVESWGLVWGKDVLDPPAPEAPAAPGDLDADQMRFEVMSEEEAAFREARRKANE
                     ARTEELAASLDRVRQPKKEAIRPTISLRKRLKPKPVTVDVKTPPPGAASPVCRRCKGKL
                     APVLQPWGRLPGDCLRVDTAVA"
ORIGIN
        1 ggccgtcgac gacgacgcgt ccgcctgcct gcttttggcc ggcgggccgg gccgcggttg
       61 tccgccgggt cggaccggtc ccttggtcga ccgatgcctc ggccacgacg atgctgggcc
      121 cgaagcggta cgcgaacccg tgccgggctg cggcggatcg cggcagcagg agctccccgc
      181 ccgccacggc tggctggatg gtcgcctcac gcgcccgcag gggtgacggc gtgggtgcgg
      241 cggtcagccc cgtgatcggg cgtcagacgg ccgctgaggg accgcgacca cccctccctt
      301 cccgcctgcc gtctttcacc gcccggccgg tccgcagacg ccgtacggcc aggccacgga
      361 ggattacggg cagatggcgc ccacccggca cccgggctgg ggcaccctgg acagcacgaa
      421 ggcccgcccc actcaccggg gcgggccttc gcgttgagct agagttcccg ccagcctcgc
      481 agagcaggat tcccgttgag caccgccagg tgcgaataag ggacagtgaa gaaggaacac
      541 ccgctcgcgg gtgggcctac ttcacctatc ctgcccggct gacgccgttg gatacaccaa
      601 ggaaagtcta cacgaaccct ttggcaaaat cctgtatatc gtgcgaaaaa ggatggatat
      661 accgaaaaaa tcgctataat gaccccgaag cagggttatg cagcggaaaa tgcagctcac
      721 ggtaactgat gccgtatttg cagtaccagc gtacggccca cagaatgatg tcacgctgaa
      781 aatgccggcc tttgaatggg ttcatgtgca gctccatcag caaaagggga tgataagttt
      841 atcaccaccg actatttgca acagtgccgt tgatcgtgct atgatcgact gatgtcatca
   
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart