pGro7

$216.00

  • Model: PVT0803
  • 50 Units in Stock
Ask a question


Add to Cart:

pGro7

PVT0803  2ug

 

pGro7 plasmid information

Plasmid classification: Escherichia coli vector; chaperone expression plasmid
Plasmid size: 5.5Kb
Prokaryotic resistance: chloramphenicol Chl
Screening markers: tetracycline Tet
Cloned strain: DH5 alpha
Culture conditions: 37 centigrade, aerobic, LB
Expression host: Escherichia coli
Culture conditions: 37 centigrade, aerobic, LB
Inducement: Arabia sugar
Remarks: plasmids of chaperone

 

pGro7 plasmid Sequence

LOCUS       Exported                5467 bp ds-DNA     circular SYN 23-MAY-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 5467)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Monday, May 23, 2016 


FEATURES             Location/Qualifiers
     source          1..5467
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             1862..1915
                     /codon_start=1
                     /product="GroES chaperone mobile loop that interacts with
                     GroEL"
                     /note="S loop"
                     /translation="EVETKSAGGIVLTGSAAA"
     rep_origin      4076..4620
                     /direction=RIGHT
                     /note="p15A ori"
                     /note="Plasmids containing the medium-copy-number p15A
                     origin of replication can be propagated in E. coli cells
                     that contain a second plasmid with the ColE1 origin."
     promoter        5146..5248
                     /note="cat promoter"
                     /note="promoter of the E. coli cat gene encoding
                     chloramphenicol acetyltransferase"
     CDS             5249..441
                     /codon_start=1
                     /gene="cat"
                     /product="chloramphenicol acetyltransferase"
                     /note="CmR"
                     /note="confers resistance to chloramphenicol"
                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL
                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS
                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM
                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"
ORIGIN
        1 cgtatggcaa tgaaagacgg tgagctggtg atatgggata gtgttcaccc ttgttacacc
       61 gttttccatg agcaaactga aacgttttca tcgctctgga gtgaatacca cgacgatttc
      121 cggcagtttc tacacatata ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat
      181 ttccctaaag ggtttattga gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc
      241 accagttttg atttaaacgt ggccaatatg gacaacttct tcgcccccgt tttcaccatg
      301 ggcaaatatt atacgcaagg cgacaaggtg ctgatgccgc tggcgattca ggttcatcat
      361 gccgtctgtg atggcttcca tgtcggcaga atgcttaatg aattacaaca gtactgcgat
      421 gagtggcagg gcggggcgta atttttttaa ggcagttatt ggtgccctta aacgcctggt
      481 gctacgcctg aataagtgat aataagcgga tgaatggcag aaattcgaag aatagttacg
      541 gcttatgaca tctttgtgga cacatcattc actttttatt cacatccggc cctgaactcg
      601 ctaggacttg ccccggtgca ttttttaaat acccgcgaaa aatagagctg atcgtcaaat
      661 ccaacattgc gcccaacggt cgctatcggc attcgcgtag tgctaagcag aagtttcgcc
      721 tggctgatac gctgatcttc gcgccagctc aatacgctaa tgcctaactg ctggcggaac
      781 agatgtgata accgggaggg cgacaggcag acatgctggg cgacgctggc gatatcaaaa
      841 tggctgtccg ccagatggtc gctgatatac tggcaggcat cgcgcacacg gctatccatc
      901 ggcgggtgca acgactcatt aattaccgcc atacgtctga gcaacaactg ctccagcaga
      961 ttgatcgcca gtagctcaga atagcgacct tccccttgcc cggcgctgat gatctgcccg
     1021 aacagttcgc tgaaatgcgg ctggcgcgcc tcgtccgggc ggaaaaatcc tgtctgggca
     1081 aagattgtcg gccaggtcag ccactcctgc cagtaggcgc gaggccggaa ataaacccac
     1141 tggtgatacc actcgctggc gtccggatgc cgtccatagt gatgaatctc gcccggcgga
     1201 aacaataata tatcgccagg ccgacagaca aactgctcgc cattattatt aatgacgccc
     1261 tctccgcgga tggtcaggtt aagaatatat cccttcatgc ccaacggacg atcgataaaa
     1321 aaatccagat atccattcgc ttcaattggc gtcagcccgg cgaccagatg ggcattaaat
     1381 gaatatcccg gcaatagcgg atcattttgc gtttcagcca tgatttctct accccccgat
     1441 gttcagagaa gaaacaaatt gtccatatcg accaggacga cagagcttcc gtctccgcaa
     1501 gactttgcgc ttgatgaaag cacgtatcaa ccccgcttgt gaaaagcgct ttgtaacaaa
     1561 agcgtacagt tcaggcgata aaattaagta acagaagtgt ctataactat ggctggaatg
     1621 tccacattga atatttgcac agcgtcacac tttgcaaagc attagcattt ttgtccataa
     1681 gattagcgga tcctgcctga cggtttttgc cgcgactctc tataatttct ccatacctgt
     1741 ttttctggat ggagtaagac catggctcga ggcgtcaccc ataacagata cggactttct
     1801 caaaggagag ttatcaatga atattcgtcc attgcatgat cgcgtgatcg tcaagcgtaa
     1861 agaagttgaa actaaatctg ctggcggcat cgttctgacc ggctctgcag cggctaaatc
     1921 cacccgcggc gaagtgctgg ctgtcggcaa tggccgtatc cttgaaaatg gcgaagtgaa
     1981 gccgctggat gtgaaagttg gcgacatcgt tattttcaac gatggctacg gtgtgaaatc
     2041 tgagaagatc gacaatgaag aagtgttgat catgtccgaa agcgacattc tggcaattgt
     2101 tgaagcgtaa tccgcgcacg acactgaaca tacgaattta aggaataaag ataatggcag
     2161 ctaaagacgt aaaattcggt aacgacgctc gtgtgaaaat gctgcgcggc gtaaacgtac
     2221 tggcagatgc agtgaaagtt accctcggtc caaaaggccg taacgtagtt ctggataaat
     2281 ctttcggtgc accgaccatc accaaagatg gtgtttccgt tgctcgtgaa atcgaactgg
     2341 aagacaagtt cgaaaatatg ggtgcgcaga tggtgaaaga agttgcctct aaagcaaacg
     2401 acgctgcagg cgacggtacc accactgcaa ccgtactggc tcaggctatc atcactgaag
     2461 gtctgaaagc tgttgctgcg ggcatgaacc cgatggacct gaaacgtggt atcgacaaag
     2521 cggttaccgc tgcagttgaa gaactgaaag cgctgtccgt accatgctct gactctaaag
     2581 cgattgctca ggttggtacc atctccgcta actccgacga aaccgtaggt aaactgatcg
     2641 ctgaagcgat ggacaaagtc ggtaaagaag gcgttatcac cgttgaagac ggtaccggtc
     2701 tgcaggacga actggacgtg gttgaaggta tgcagttcga ccgtggctac ctgtctcctt
     2761 acttcatcaa caagccggaa actggcgcag tagaactgga aagcccgttc atcctgctgg
     2821 ctgacaagaa aatctccaac atccgcgaaa tgctgccggt tctggaagct gttgccaaag
     2881 caggcaaacc gctgctgatc atcgctgaag atgtagaagg cgaagcgctg gcaactctgg
     2941 ttgttaacac catgcgtggc atcgtgaaag tcgctgcggt taaagcaccg ggcttcggcg
     3001 atcgtcgtaa agctatgctg caggatatcg caaccctgac tggcggtacc gtgatctctg
     3061 aagagatcgg tatggagctg gaaaaagcaa ccctggaaga cctgggtcag gctaaacgtg
     3121 ttgtgatcaa caaagacacc accactatca tcgatggcgt gggtgaagaa gctgcaatcc
     3181 agggccgtgt tgctcagatc cgtcagcaga ttgaagaagc aacttctgac tacgaccgtg
     3241 aaaaactgca ggaacgcgta gcgaaactgg caggcggcgt tgcagttatc aaagtgggtg
     3301 ctgctaccga agttgaaatg aaagagaaaa aagcacgcgt tgaagatgcc ctgcacgcga
     3361 cccgtgctgc ggtagaagaa ggcgtggttg ctggtggtgg tgttgcgctg atccgcgtag
     3421 cgtctaaact ggctgacctg cgtggtcaga acgaagacca gaacgtgggt atcaaagttg
     3481 cactgcgtgc aatggaagct ccgctgcgtc agatcgtatt gaactgcggc gaagaaccgt
     3541 ctgttgttgc taacaccgtt aaaggcggcg acggcaacta cggttacaac gcagcaaccg
     3601 aagaatacgg caacatgatc gacatgggta tcctggatcc aaccaaagta actcgttctg
     3661 ctctgcagta cgcagcttct gtggctggcc tgatgatcac caccgaatgc atggttaccg
     3721 acctgccgaa aaacgatgca gctgacttag gcgctgctgg cggtatgggc ggcatgggtg
     3781 gcatgggcgg catgatgtaa ttgccctgca cctcgcagaa ataaacaaac ccccgggcag
     3841 aaatgtctgg gggtttttct tttggtcatc tttctagtat aagattcaga cacggacgac
     3901 gcgagtggcg cctcgaggcg ccgatatcag atctggtacc aagcttatcg atgataagct
     3961 gtcaaacatg agaattacaa cttatatcgt atggggctga cttcaggtgc tacatttgaa
     4021 gagataaatt gcactgaaat ctagaaatat ttatctgatt aataagatga tcttcttgag
     4081 atcgttttgg tctgcgcgta atctcttgct ctgaaaacga aaaaaccgcc ttgcagggcg
     4141 gtttttcgaa ggttctctga gctaccaact ctttgaaccg aggtaactgg cttggaggag
     4201 cgcagtcacc aaaacttgtc ctttcagttt agccttaacc ggcgcatgac ttcaagacta
     4261 actcctctaa atcaattacc agtggctgct gccagtggtg cttttgcatg tctttccggg
     4321 ttggactcaa gacgatagtt accggataag gcgcagcggt cggactgaac ggggggttcg
     4381 tgcatacagt ccagcttgga gcgaactgcc tacccggaac tgagtgtcag gcgtggaatg
     4441 agacaaacgc ggccataaca gcggaatgac accggtaaac cgaaaggcag gaacaggaga
     4501 gcgcacgagg gagccgccag gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc
     4561 caccactgat ttgagcgtca gatttcgtga tgcttgtcag gggggcggag cctatggaaa
     4621 aacggctttg ccgcggccct ctcacttccc tgttaagtat cttcctggca tcttccagga
     4681 aatctccgcc ccgttcgtaa gccatttccg ctcgccgcag tcgaacgacc gagcgtagcg
     4741 agtcagtgag cgaggaagcg gaatatatcc tgtatcacat attctgctga cgcaccggtg
     4801 cagccttttt tctcctgcca catgaagcac ttcactgaca ccctcatcag tgccaacata
     4861 gtaagccagt atacactccg ctagcgctga tgtccggcgg tgcttttgcc gttacgcacc
     4921 accccgtcag tagctgaaca ggagggacag ctgatagaaa cagaagccac tggagcacct
     4981 caaaaacacc atcatacact aaatcagtaa gttggcagca tcacccgacg cactttgcgc
     5041 cgaataaata cctgtgacgg aagatcactt cgcagaataa ataaatcctg gtgtccctgt
     5101 tgataccggg aagccctggg ccaacttttg gcgaaaatga gacgttgatc ggcacgtaag
     5161 aggttccaac tttcaccata atgaaataag atcactaccg ggcgtatttt ttgagttatc
     5221 gagattttca ggagctaagg aagctaaaat ggagaaaaaa atcactggat ataccaccgt
     5281 tgatatatcc caatggcatc gtaaagaaca ttttgaggca tttcagtcag ttgctcaatg
     5341 tacctataac cagaccgttc agctggatat tacggccttt ttaaagaccg taaagaaaaa
     5401 taagcacaag ttttatccgg cctttattca cattcttgcc cgcctgatga atgctcatcc
     5461 ggaattc
//

 

Caution:

  1. This product is FOR RESEARCH USE ONLY!

Search name

pGro7,Plasmid pGro7,pGro7 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart