pGWB11

$260.00

  • Model: PVT11150
  • 50 Units in Stock
Ask a question


Add to Cart:

pGWB11


Catalog No. PVT11150
Packing 2ug

 

pGWB11 Description

Function plant expression plasmid

Prokaryotic resistance: Kan

Screening markers: hyg, G418

Clone strain: DB3.1

Culture condition: 37 ℃

Host: plant

Application of vector: protein expression

Gene species:-

Gene type:-

Prokaryotic resistance: Kan

Eukaryotic resistance: G418, hyg

 

pGWB11 Sequence

LOCUS       Exported               17260 bp ds-DNA     circular SYN 25-JAN-2018

FEATURES             Location/Qualifiers

     source          1..17260

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     misc_feature    2454..2478

                     /label=RB

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2634..2817

                     /function="NOS promoter"

                     /label=NOS

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=Neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /label=NOS

                     /note="nopaline synthase terminator and poly(A) signal"

     promoter        5461..5806

                     /label=35S

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     protein_bind    5828..5952

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        5989..6019

                     /label=lac UV5

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             6073..6732

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=Chl

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             7074..7379

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(7420..7544)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             7555..7578

                     /codon_start=1

                     /product="FLAG(R) epitope tag, followed by an enterokinase 

                     cleavage site"

                     /label=FLAG

                     /translation="DYKDDDDK"

     terminator      7600..7852

                     /label=NOS

                     /note="nopaline synthase terminator and poly(A) signal"

     terminator      8281..8533

                     /label=NOS

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(9001..10026)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=Hyg

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     E"

     promoter        complement(10036..10380)

                     /label=35S

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     misc_feature    11124..11148

                     /label=LB

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(12744..13892)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(14191..14985)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=Kan

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  15177..15944

                     /mobile_element_type="insertion sequence:IS1"

                     /note="prokaryotic transposable element"

     rep_origin      16567..18

                     /label=oriV

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggtc cccagattag

     4981 ccttttcaat ttcagaaaga atgctaaccc acagatggtt agagaggctt acgcagcagg

     5041 tctcatcaag acgatctacc cgagcaataa tctccaggaa atcaaatacc ttcccaagaa

     5101 ggttaaagat gcagtcaaaa gattcaggac taactgcatc aagaacacag agaaagatat

     5161 atttctcaag atcagaagta ctattccagt atggacgatt caaggcttgc ttcacaaacc

     5221 aaggcaagta atagagattg gagtctctaa aaaggtagtt cccactgaat caaaggccat

     5281 ggagtcaaag attcaaatag aggacctaac agaactcgcc gtaaagactg gcgaacagtt

     5341 catacagagt ctcttacgac tcaatgacaa gaagaaaatc ttcgtcaaca tggtggagca

     5401 cgacacactt gtctactcca aaaatatcaa agatacagtc tcagaagacc aaagggcaat

     5461 tgagactttt caacaaaggg taatatccgg aaacctcctc ggattccatt gcccagctat

     5521 ctgtcacttt attgtgaaga tagtggaaaa ggaaggtggc tcctacaaat gccatcattg

     5581 cgataaagga aaggccatcg ttgaagatgc ctctgccgac agtggtccca aagatggacc

     5641 cccacccacg aggagcatcg tggaaaaaga agacgttcca accacgtctt caaagcaagt

     5701 ggattgatgt gatatctcca ctgacgtaag ggatgacgca caatcccact atccttcgca

     5761 agacccttcc tctatataag gaagttcatt tcatttggag agaacacggg ggactctaga

     5821 gttatcaaca agtttgtaca aaaaagctga acgagaaacg taaaatgata taaatatcaa

     5881 tatattaaat tagattttgc ataaaaaaca gactacataa tactgtaaaa cacaacatat

     5941 ccagtcacta tggcggcccc tcgaggggcc gcattaggca ccccaggctt tacactttat

     6001 gcttccggct cgtataatgt gtggattttg agttaggatc cggcgagatt ttcaggagct

     6061 aaggaagcta aaatggagaa aaaaatcact ggatatacca ccgttgatat atcccaatgg

     6121 catcgtaaag aacattttga ggcatttcag tcagttgctc aatgtaccta taaccagacc

     6181 gttcagctgg atattacggc ctttttaaag accgtaaaga aaaataagca caagttttat

     6241 ccggccttta ttcacattct tgcccgcctg atgaatgctc atccggaatt ccgtatggca

     6301 atgaaagacg gtgagctggt gatatgggat agtgttcacc cttgttacac cgttttccat

     6361 gagcaaactg aaacgttttc atcgctctgg agtgaatacc acgacgattt ccggcagttt

     6421 ctacacatat attcgcaaga tgtggcgtgt tacggtgaaa acctggccta tttccctaaa

     6481 gggtttattg agaatatgtt tttcgtctca gccaatccct gggtgagttt caccagtttt

     6541 gatttaaacg tggccaatat ggacaacttc ttcgcccccg ttttcaccat gggcaaatat

     6601 tatacgcaag gcgacaaggt gctgatgccg ctggcgattc aggttcatca tgccgtctgt

     6661 gatggcttcc atgtcggcag aatgcttaat gaattacaac agtactgcga tgagtggcag

     6721 ggcggggcgt aaagatctgg atccggctta ctaaaagcca gataacagta tgcgtatttg

     6781 cgcgctgatt tttgcggtat aagaatatat actgatatgt atacccgaag tatgtcaaaa

     6841 agaggtgtgc tatgaagcag cgtattacag tgacagttga cagcgacagc tatcagttgc

     6901 tcaaggcata tatgatgtca atatctccgg tctggtaagc acaaccatgc agaatgaagc

     6961 ccgtcgtctg cgtgccgaac gctggaaagc ggaaaatcag gaagggatgg ctgaggtcgc

     7021 ccggtttatt gaaatgaacg gctcttttgc tgacgagaac agggactggt gaaatgcagt

     7081 ttaaggttta cacctataaa agagagagcc gttatcgtct gtttgtggat gtacagagtg

     7141 atattattga cacgcccggg cgacggatgg tgatccccct ggccagtgca cgtctgctgt

     7201 cagataaagt ctcccgtgaa ctttacccgg tggtgcatat cggggatgaa agctggcgca

     7261 tgatgaccac cgatatggcc agtgtgccgg tctccgttat cggggaagaa gtggctgatc

     7321 tcagccaccg cgaaaatgac atcaaaaacg ccattaacct gatgttctgg ggaatataaa

     7381 tgtcaggctc ccttatacac agccagtctg caggtcgacc atagtgactg gatatgttgt

     7441 gttttacagt attatgtagt ctgtttttta tgcaaaatct aatttaatat attgatattt

     7501 atatcatttt acgtttctcg ttcagctttc ttgtacaaag tggttgataa cagcgactac

     7561 aaggatgacg atgacaaggc ttagagctcg aatttccccg atcgttcaaa catttggcaa

     7621 taaagtttct taagattgaa tcctgttgcc ggtcttgcga tgattatcat ataatttctg

     7681 ttgaattacg ttaagcatgt aataattaac atgtaatgca tgacgttatt tatgagatgg

     7741 gtttttatga ttagagtccc gcaattatac atttaatacg cgatagaaaa caaaatatag

     7801 cgcgcaaact aggataaatt atcgcgcgcg gtgtcatcta tgttactaga tcgggaatta

     7861 gcttcatcaa cgcaagacat gcgcacgacc gtctgacagg agaggaattt ccgacgagca

     7921 cagaaaggac ttgctcttgg acgtaggcct atttctcagg cacatgtatc aagtgttcgg

     7981 acgtgggttt tcgatggtgt atcagccgcc gccaactggg agatgaggag gctttcttgg

     8041 ggggcagtca gcagttcatt tcacaagaca gaggaacttg taaggagatg cactgattta

     8101 tcttggcgca aaccagcagg acgaattagt gggaatagcc cgcgaatatc taagttatgc

     8161 ctgtcggcat gagcagaaac ttccaattcg aaacagtttg gagaggttgt ttttgggcat

     8221 accttttgtt agtcagcctc tcgattgctc atcgtcatta cacagtaccg aagtttgatc

     8281 gatctagtaa catagatgac accgcgcgcg ataatttatc ctagtttgcg cgctatattt

     8341 tgttttctat cgcgtattaa atgtataatt gcgggactct aatcataaaa acccatctca

     8401 taaataacgt catgcattac atgttaatta ttacatgctt aacgtaattc aacagaaatt

     8461 atatgataat catcgcaaga ccggcaacag gattcaatct taagaaactt tattgccaaa

     8521 tgtttgaacg atctgcttcg acgcactcct tctttactcc accatctcgt ccttattgaa

     8581 aacgtgggta gcaccaaaac gaatcaagtc gctggaactg aagttaccaa tcacgctgga

     8641 tgatttgcca gttggattaa tcttgccttt ccccgcatga ataatattga tgaatgcatg

     8701 cgtgaggggt atttcgattt tggcaatagc tgcaattgcc gcgacatcct ccaacgagca

     8761 taattcttca gaaaaatagc gatgttccat gttgtcaggg catgcatgat gcacgttatg

     8821 aggtgacggt gctaggcagt attccctcaa agtttcatag tcagtatcat attcatcatt

     8881 gcattcctgc aagagagaat tgagacgcaa tccacacgct gcggcaacct tccggcgttc

     8941 gtggtctatt tgctcttgga cgttgcaaac gtaagtgttg gatcccggtc ggcatctact

     9001 ctattccttt gccctcggac gagtgctggg gcgtcggttt ccactatcgg cgagtacttc

     9061 tacacagcca tcggtccaga cggccgcgct tctgcgggcg atttgtgtac gcccgacagt

     9121 cccggctccg gatcggacga ttgcgtcgca tcgaccctgc gcccaagctg catcatcgaa

     9181 attgccgtca accaagctct gatagagttg gtcaagacca atgcggagca tatacgcccg

     9241 gagccgcggc gatcctgcaa gctccggatg cctccgctcg aagtagcgcg tctgctgctc

     9301 catacaagcc aaccacggcc tccagaagaa gatgttggcg acctcgtatt gggaatcccc

     9361 gaacatcgcc tcgctccagt caatgaccgc tgttatgcgg ccattgtccg tcaggacatt

     9421 gttggagccg aaatccgcgt gcacgaggtg ccggacttcg gggcagtcct cggcccaaag

     9481 catcagctca tcgagagcct gcgcgacgga cgcactgacg gtgtcgtcca tcacagtttg

     9541 ccagtgatac acatggggat cagcaatcgc gcatatgaaa tcacgccatg tagtgtattg

     9601 accgattcct tgcggtccga atgggccgaa cccgctcgtc tggctaagat cggccgcagc

     9661 gatcgcatcc atggcctccg cgaccggctg cagaacagcg ggcagttcgg tttcaggcag

     9721 gtcttgcaac gtgacaccct gtgcacggcg ggagatgcaa taggtcaggc tctcgctgaa

     9781 ttccccaatg tcaagcactt ccggaatcgg gagcgcggcc gatgcaaagt gccgataaac

     9841 ataacgatct ttgtagaaac catcggcgca gctatttacc cgcaggacat atccacgccc

     9901 tcctacatcg aagctgaaag cacgagattc ttcgccctcc gagagctgca tcaggtcgga

     9961 gacgctgtcg aacttttcga tcagaaactt ctcgacagac gtcgcggtga gttcaggctt

    10021 tttcatatcg gggtcgtcct ctccaaatga aatgaacttc cttatataga ggaagggtct

    10081 tgcgaaggat agtgggattg tgcgtcatcc cttacgtcag tggagatatc acatcaatcc

    10141 acttgctttg aagacgtggt tggaacgtct tctttttcca cgatgctcct cgtgggtggg

    10201 ggtccatctt tgggaccact gtcggcagag gcatcttgaa cgatagcctt tcctttatcg

    10261 caatgatggc atttgtaggt gccaccttcc ttttctactg tccttttgat gaagtgacag

    10321 atagctgggc aatggaatcc gaggaggttt cccgatatta ccctttgttg aaaagtctca

    10381 atagcccttt ggtcttctga gactgtatct ttgatattct tggagtagac gagagtgtcg

    10441 tgctccacca tgttgacgga tctctaggac gcgtcctaga agctaattca ctggccgtcg

    10501 ttttacaacg tcgtgactgg gaaaaccctg gcgttaccca acttaatcgc cttgcagcac

    10561 atcccccttt cgccagctgg cgtaatagcg aagaggcccg caccgatcgc ccttcccaac

    10621 agttgcgcag cctgaatggc gcccgctcct ttcgctttct tcccttcctt tctcgccacg

    10681 ttcgccggct ttccccgtca agctctaaat cgggggctcc ctttagggtt ccgatttagt

    10741 gctttacggc acctcgaccc caaaaaactt gatttgggtg atggttcacg tagtgggcca

    10801 tcgccctgat agacggtttt tcgccctttg acgttggagt ccacgttctt taatagtgga

    10861 ctcttgttcc aaactggaac aacactcaac cctatctcgg gctattcttt tgatttataa

    10921 gggattttgc cgatttcgga accaccatca aacaggattt tcgcctgctg gggcaaacca

    10981 gcgtggaccg cttgctgcaa ctctctcagg gccaggcggt gaagggcaat cagctgttgc

    11041 ccgtctcact ggtgaaaaga aaaaccaccc cagtacatta aaaacgtccg caatgtgtta

    11101 ttaagttgtc taagcgtcaa tttgtttaca ccacaatata tcctgccacc agccagccaa

    11161 cagctccccg accggcagct cggcacaaaa tcaccactcg atacaggcag cccatcagtc

    11221 cgggacggcg tcagcgggag agccgttgta aggcggcaga ctttgctcat gttaccgatg

    11281 ctattcggaa gaacggcaac taagctgccg ggtttgaaac acggatgatc tcgcggaggg

    11341 tagcatgttg attgtaacga tgacagagcg ttgctgcctg tgatcaaata tcatctccct

    11401 cgcagagatc cgaattatca gccttcttat tcatttctcg cttaaccgtg acaggctgtc

    11461 gatcttgaga actatgccga cataatagga aatcgctgga taaagccgct gaggaagctg

    11521 agtggcgcta tttctttaga agtgaacgtt gacgatatca actcccctat ccattgctca

    11581 ccgaatggta caggtcgggg acccgaagtt ccgactgtcg gcctgatgca tccccggctg

    11641 atcgacccca gatctggggc tgagaaagcc cagtaaggaa acaactgtag gttcgagtcg

    11701 cgagatcccc cggaaccaaa ggaagtaggt taaacccgct ccgatcaggc cgagccacgc

    11761 caggccgaga acattggttc ctgtaggcat cgggattggc ggatcaaaca ctaaagctac

    11821 tggaacgagc agaagtcctc cggccgccag ttgccaggcg gtaaaggtga gcagaggcac

    11881 gggaggttgc cacttgcggg tcagcacggt tccgaacgcc atggaaaccg cccccgccag

    11941 gcccgctgcg acgccgacag gatctagcgc tgcgtttggt gtcaacacca acagcgccac

    12001 gcccgcagtt ccgcaaatag cccccaggac cgccatcaat cgtatcgggc tacctagcag

    12061 agcggcagag atgaacacga ccatcagcgg ctgcacagcg cctaccgtcg ccgcgacccc

    12121 gcccggcagg cggtagaccg aaataaacaa caagctccag aatagcgaaa tattaagtgc

    12181 gccgaggatg aagatgcgca tccaccagat tcccgttgga atctgtcgga cgatcatcac

    12241 gagcaataaa cccgccggca acgcccgcag cagcataccg gcgacccctc ggcctcgctg

    12301 ttcgggctcc acgaaaacgc cggacagatg cgccttgtga gcgtccttgg ggccgtcctc

    12361 ctgtttgaag accgacagcc caatgatctc gccgtcgatg taggcgccga atgccacggc

    12421 atctcgcaac cgttcagcga acgcctccat gggctttttc tcctcgtgct cgtaaacgga

    12481 cccgaacatc tctggagctt tcttcagggc cgacaatcgg atctcgcgga aatcctgcac

    12541 gtcggccgct ccaagccgtc gaatctgagc cttaatcaca attgtcaatt ttaatcctct

    12601 gtttatcggc agttcgtaga gcgcgccgtg cgtcccgagc gatactgagc gaagcaagtg

    12661 cgtcgagcag tgcccgcttg ttcctgaaat gccagtaaag cgctggctgc tgaaccccca

    12721 gccggaactg accccacaag gccctagcgt ttgcaatgca ccaggtcatc attgacccag

    12781 gcgtgttcca ccaggccgct gcctcgcaac tcttcgcagg cttcgccgac ctgctcgcgc

    12841 cacttcttca cgcgggtgga atccgatccg cacatgaggc ggaaggtttc cagcttgagc

    12901 gggtacggct cccggtgcga gctgaaatag tcgaacatcc gtcgggccgt cggcgacagc

    12961 ttgcggtact tctcccatat gaatttcgtg tagtggtcgc cagcaaacag cacgacgatt

    13021 tcctcgtcga tcaggacctg gcaacgggac gttttcttgc cacggtccag gacgcggaag

    13081 cggtgcagca gcgacaccga ttccaggtgc ccaacgcggt cggacgtgaa gcccatcgcc

    13141 gtcgcctgta ggcgcgacag gcattcctcg gccttcgtgt aataccggcc attgatcgac

    13201 cagcccaggt cctggcaaag ctcgtagaac gtgaaggtga tcggctcgcc gataggggtg

    13261 cgcttcgcgt actccaacac ctgctgccac accagttcgt catcgtcggc ccgcagctcg

    13321 acgccggtgt aggtgatctt cacgtccttg ttgacgtgga aaatgacctt gttttgcagc

    13381 gcctcgcgcg ggattttctt gttgcgcgtg gtgaacaggg cagagcgggc cgtgtcgttt

    13441 ggcatcgctc gcatcgtgtc cggccacggc gcaatatcga acaaggaaag ctgcatttcc

    13501 ttgatctgct gcttcgtgtg tttcagcaac gcggcctgct tggcctcgct gacctgtttt

    13561 gccaggtcct cgccggcggt ttttcgcttc ttggtcgtca tagttcctcg cgtgtcgatg

    13621 gtcatcgact tcgccaaacc tgccgcctcc tgttcgagac gacgcgaacg ctccacggcg

    13681 gccgatggcg cgggcagggc agggggagcc agttgcacgc tgtcgcgctc gatcttggcc

    13741 gtagcttgct ggaccatcga gccgacggac tggaaggttt cgcggggcgc acgcatgacg

    13801 gtgcggcttg cgatggtttc ggcatcctcg gcggaaaacc ccgcgtcgat cagttcttgc

    13861 ctgtatgcct tccggtcaaa cgtccgattc attcaccctc cttgcgggat tgccccgact

    13921 cacgccgggg caatgtgccc ttattcctga tttgacccgc ctggtgcctt ggtgtccaga

    13981 taatccacct tatcggcaat gaagtcggtc ccgtagaccg tctggccgtc cttctcgtac

    14041 ttggtattcc gaatcttgcc ctgcacgaat accagcgacc ccttgcccaa atacttgccg

    14101 tgggcctcgg cctgagagcc aaaacacttg atgcggaaga agtcggtgcg ctcctgcttg

    14161 tcgccggcat cgttgcgcca catctaggta ctaaaacaat tcatccagta aaatataata

    14221 ttttattttc tcccaatcag gcttgatccc cagtaagtca aaaaatagct cgacatactg

    14281 ttcttccccg atatcctccc tgatcgaccg gacgcagaag gcaatgtcat accacttgtc

    14341 cgccctgccg cttctcccaa gatcaataaa gccacttact ttgccatctt tcacaaagat

    14401 gttgctgtct cccaggtcgc cgtgggaaaa gacaagttcc tcttcgggct tttccgtctt

    14461 taaaaaatca tacagctcgc gcggatcttt aaatggagtg tcttcttccc agttttcgca

    14521 atccacatcg gccagatcgt tattcagtaa gtaatccaat tcggctaagc ggctgtctaa

    14581 gctattcgta tagggacaat ccgatatgtc gatggagtga aagagcctga tgcactccgc

    14641 atacagctcg ataatctttt cagggctttg ttcatcttca tactcttccg agcaaaggac

    14701 gccatcggcc tcactcatga gcagattgct ccagccatca tgccgttcaa agtgcaggac

    14761 ctttggaaca ggcagctttc cttccagcca tagcatcatg tccttttccc gttccacatc

    14821 ataggtggtc cctttatacc ggctgtccgt catttttaaa tataggtttt cattttctcc

    14881 caccagctta tataccttag caggagacat tccttccgta tcttttacgc agcggtattt

    14941 ttcgatcagt tttttcaatt ccggtgatat tctcatttta gccatttatt atttccttcc

    15001 tcttttctac agtatttaaa gataccccaa gaagctaatt ataacaagac gaactccaat

    15061 tcactgttcc ttgcattcta aaaccttaaa taccagaaaa cagctttttc aaagttgttt

    15121 tcaaagttgg cgtataacat agtatcgacg gagccgattt tgaaaccaca attatgggtg

    15181 atgctgccaa cttactgatt tagtgtatga tggtgttttt gaggtgctcc agtggcttct

    15241 gtgtctatca gctgtccctc ctgttcagct actgacgggg tggtgcgtaa cggcaaaagc

    15301 accgccggac atcagcgcta tctctgctct cactgccgta aaacatggca actgcagttc

    15361 acttacaccg cttctcaacc cggtacgcac cagaaaatca ttgatatggc catgaatggc

    15421 gttggatgcc gggcaacagc ccgcattatg ggcgttggcc tcaacacgat tttacgtcac

    15481 ttaaaaaact caggccgcag tcggtaacct cgcgcataca gccgggcagt gacgtcatcg

    15541 tctgcgcgga aatggacgaa cagtggggct atgtcggggc taaatcgcgc cagcgctggc

    15601 tgttttacgc gtatgacagt ctccggaaga cggttgttgc gcacgtattc ggtgaacgca

    15661 ctatggcgac gctggggcgt cttatgagcc tgctgtcacc ctttgacgtg gtgatatgga

    15721 tgacggatgg ctggccgctg tatgaatccc gcctgaaggg aaagctgcac gtaatcagca

    15781 agcgatatac gcagcgaatt gagcggcata acctgaatct gaggcagcac ctggcacggc

    15841 tgggacggaa gtcgctgtcg ttctcaaaat cggtggagct gcatgacaaa gtcatcgggc

    15901 attatctgaa cataaaacac tatcaataag ttggagtcat tacccaatta tgatagaatt

    15961 tacaagctat aaggttattg tcctgggttt caagcattag tccatgcaag tttttatgct

    16021 ttgcccattc tatagatata ttgataagcg cgctgcctat gccttgcccc ctgaaatcct

    16081 tacatacggc gatatcttct atataaaaga tatattatct tatcagtatt gtcaatatat

    16141 tcaaggcaat ctgcctcctc atcctcttca tcctcttcgt cttggtagct ttttaaatat

    16201 ggcgcttcat agagtaattc tgtaaaggtc caattctcgt tttcatacct cggtataatc

    16261 ttacctatca cctcaaatgg ttcgctgggt ttatcgcacc cccgaacacg agcacggcac

    16321 ccgcgaccac tatgccaaga atgcccaagg taaaaattgc cggccccgcc atgaagtccg

    16381 tgaatgcccc gacggccgaa gtgaagggca ggccgccacc caggccgccg ccctcactgc

    16441 ccggcacctg gtcgctgaat gtcgatgcca gcacctgcgg cacgtcaatg cttccgggcg

    16501 tcgcgctcgg gctgatcgcc catcccgtta ctgccccgat cccggcaatg gcaaggactg

    16561 ccagcgctgc catttttggg gtgaggccgt tcgcggccga ggggcgcagc ccctgggggg

    16621 atgggaggcc cgcgttagcg ggccgggagg gttcgagaag ggggggcacc ccccttcggc

    16681 gtgcgcggtc acgcgcacag ggcgcagccc tggttaaaaa caaggtttat aaatattggt

    16741 ttaaaagcag gttaaaagac aggttagcgg tggccgaaaa acgggcggaa acccttgcaa

    16801 atgctggatt ttctgcctgt ggacagcccc tcaaatgtca ataggtgcgc ccctcatctg

    16861 tcagcactct gcccctcaag tgtcaaggat cgcgcccctc atctgtcagt agtcgcgccc

    16921 ctcaagtgtc aataccgcag ggcacttatc cccaggcttg tccacatcat ctgtgggaaa

    16981 ctcgcgtaaa atcaggcgtt ttcgccgatt tgcgaggctg gccagctcca cgtcgccggc

    17041 cgaaatcgag cctgcccctc atctgtcaac gccgcgccgg gtgagtcggc ccctcaagtg

    17101 tcaacgtccg cccctcatct gtcagtgagg gccaagtttt ccgcgaggta tccacaacgc

    17161 cggcggccgc ggtgtctcgc acacggcttc gacggcgttt ctggcgcgtt tgcagggcca

    17221 tagacggccg ccagcccagc ggcgagggca accagcccgg

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart