pGWB18

$260.00

  • Model: PVT11153
  • 50 Units in Stock
Ask a question


Add to Cart:

pGWB18

Catalog No. PVT11153
Packing 2ug


pGWB18 Informaiton
Function plant expression plasmid
Resistance Kan
Screen Hyg/Neo/G418
Strain DB3.1
Culture temperature 37degrees centigrade
Replicon
Copy
Promoter
Induction
Forward primer
Reverse primer

 

pGWB18 Description

PGWB18 is a GateWay series of plant expression plasmids.

 

pGWB18 Sequence

LOCUS       Exported               17409 bp ds-DNA     circular SYN 27-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..17409

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /label=TetR

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2634..2817

                     /function="NOS promoter"

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=NeoR/KanR

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     promoter        5461..5806

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             5842..5871

                     /codon_start=1

                     /product="Myc (human c-Myc proto-oncogene) epitope tag"

                     /label=Myc

                     /translation="EQKLISEEDL"

     CDS             5878..5907

                     /codon_start=1

                     /product="Myc (human c-Myc proto-oncogene) epitope tag"

                     /label=Myc

                     /translation="EQKLISEEDL"

     CDS             5923..5952

                     /codon_start=1

                     /product="Myc (human c-Myc proto-oncogene) epitope tag"

                     /label=Myc

                     /translation="EQKLISEEDL"

     CDS             5959..5988

                     /codon_start=1

                     /product="Myc (human c-Myc proto-oncogene) epitope tag"

                     /label=Myc

                     /translation="EQKLISEEDL"

     protein_bind    6007..6131

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        6168..6198

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             6252..6911

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             7253..7558

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(7599..7723)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     terminator      7749..8001

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     terminator      8430..8682

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(9150..10175)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     E"

     promoter        complement(10185..10529)

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     misc_feature    11273..11297

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(12893..14041)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(14340..15134)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  15326..16093

                     /mobile_element_type="insertion sequence:IS1"

                     /note="prokaryotic transposable element"

     rep_origin      16716..18

                     /label=oriV

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggtc cccagattag

     4981 ccttttcaat ttcagaaaga atgctaaccc acagatggtt agagaggctt acgcagcagg

     5041 tctcatcaag acgatctacc cgagcaataa tctccaggaa atcaaatacc ttcccaagaa

     5101 ggttaaagat gcagtcaaaa gattcaggac taactgcatc aagaacacag agaaagatat

     5161 atttctcaag atcagaagta ctattccagt atggacgatt caaggcttgc ttcacaaacc

     5221 aaggcaagta atagagattg gagtctctaa aaaggtagtt cccactgaat caaaggccat

     5281 ggagtcaaag attcaaatag aggacctaac agaactcgcc gtaaagactg gcgaacagtt

     5341 catacagagt ctcttacgac tcaatgacaa gaagaaaatc ttcgtcaaca tggtggagca

     5401 cgacacactt gtctactcca aaaatatcaa agatacagtc tcagaagacc aaagggcaat

     5461 tgagactttt caacaaaggg taatatccgg aaacctcctc ggattccatt gcccagctat

     5521 ctgtcacttt attgtgaaga tagtggaaaa ggaaggtggc tcctacaaat gccatcattg

     5581 cgataaagga aaggccatcg ttgaagatgc ctctgccgac agtggtccca aagatggacc

     5641 cccacccacg aggagcatcg tggaaaaaga agacgttcca accacgtctt caaagcaagt

     5701 ggattgatgt gatatctcca ctgacgtaag ggatgacgca caatcccact atccttcgca

     5761 agacccttcc tctatataag gaagttcatt tcatttggag agaacacggg ggactctaga

     5821 atgagcgggt taattaacgg tgaacaaaag ctaatctccg aggaagactt gaacggtgaa

     5881 caaaaattaa tctcagaaga agacttgaac ggactcgacg gtgaacaaaa gttgatttct

     5941 gaagaagatt tgaacggtga acaaaagcta atctccgagg aagacttgaa cggtagcgct

     6001 gttatcacaa gtttgtacaa aaaagctgaa cgagaaacgt aaaatgatat aaatatcaat

     6061 atattaaatt agattttgca taaaaaacag actacataat actgtaaaac acaacatatc

     6121 cagtcactat ggcggcccct cgaggggccg cattaggcac cccaggcttt acactttatg

     6181 cttccggctc gtataatgtg tggattttga gttaggatcc ggcgagattt tcaggagcta

     6241 aggaagctaa aatggagaaa aaaatcactg gatataccac cgttgatata tcccaatggc

     6301 atcgtaaaga acattttgag gcatttcagt cagttgctca atgtacctat aaccagaccg

     6361 ttcagctgga tattacggcc tttttaaaga ccgtaaagaa aaataagcac aagttttatc

     6421 cggcctttat tcacattctt gcccgcctga tgaatgctca tccggaattc cgtatggcaa

     6481 tgaaagacgg tgagctggtg atatgggata gtgttcaccc ttgttacacc gttttccatg

     6541 agcaaactga aacgttttca tcgctctgga gtgaatacca cgacgatttc cggcagtttc

     6601 tacacatata ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat ttccctaaag

     6661 ggtttattga gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc accagttttg

     6721 atttaaacgt ggccaatatg gacaacttct tcgcccccgt tttcaccatg ggcaaatatt

     6781 atacgcaagg cgacaaggtg ctgatgccgc tggcgattca ggttcatcat gccgtctgtg

     6841 atggcttcca tgtcggcaga atgcttaatg aattacaaca gtactgcgat gagtggcagg

     6901 gcggggcgta aacgcgtgga tccggcttac taaaagccag ataacagtat gcgtatttgc

     6961 gcgctgattt ttgcggtata agaatatata ctgatatgta tacccgaagt atgtcaaaaa

     7021 gaggtgtgct atgaagcagc gtattacagt gacagttgac agcgacagct atcagttgct

     7081 caaggcatat atgatgtcaa tatctccggt ctggtaagca caaccatgca gaatgaagcc

     7141 cgtcgtctgc gtgccgaacg ctggaaagcg gaaaatcagg aagggatggc tgaggtcgcc

     7201 cggtttattg aaatgaacgg ctcttttgct gacgagaaca gggactggtg aaatgcagtt

     7261 taaggtttac acctataaaa gagagagccg ttatcgtctg tttgtggatg tacagagtga

     7321 tattattgac acgcccgggc gacggatggt gatccccctg gccagtgcac gtctgctgtc

     7381 agataaagtc tcccgtgaac tttacccggt ggtgcatatc ggggatgaaa gctggcgcat

     7441 gatgaccacc gatatggcca gtgtgccggt ctccgttatc ggggaagaag tggctgatct

     7501 cagccaccgc gaaaatgaca tcaaaaacgc cattaacctg atgttctggg gaatataaat

     7561 gtcaggctcc cttatacaca gccagtctgc aggtcgacca tagtgactgg atatgttgtg

     7621 ttttacagta ttatgtagtc tgttttttat gcaaaatcta atttaatata ttgatattta

     7681 tatcatttta cgtttctcgt tcagctttct tgtacaaagt ggtgataacc tagagctcga

     7741 atttccccga tcgttcaaac atttggcaat aaagtttctt aagattgaat cctgttgccg

     7801 gtcttgcgat gattatcata taatttctgt tgaattacgt taagcatgta ataattaaca

     7861 tgtaatgcat gacgttattt atgagatggg tttttatgat tagagtcccg caattataca

     7921 tttaatacgc gatagaaaac aaaatatagc gcgcaaacta ggataaatta tcgcgcgcgg

     7981 tgtcatctat gttactagat cgggaattag cttcatcaac gcaagacatg cgcacgaccg

     8041 tctgacagga gaggaatttc cgacgagcac agaaaggact tgctcttgga cgtaggccta

     8101 tttctcaggc acatgtatca agtgttcgga cgtgggtttt cgatggtgta tcagccgccg

     8161 ccaactggga gatgaggagg ctttcttggg gggcagtcag cagttcattt cacaagacag

     8221 aggaacttgt aaggagatgc actgatttat cttggcgcaa accagcagga cgaattagtg

     8281 ggaatagccc gcgaatatct aagttatgcc tgtcggcatg agcagaaact tccaattcga

     8341 aacagtttgg agaggttgtt tttgggcata ccttttgtta gtcagcctct cgattgctca

     8401 tcgtcattac acagtaccga agtttgatcg atctagtaac atagatgaca ccgcgcgcga

     8461 taatttatcc tagtttgcgc gctatatttt gttttctatc gcgtattaaa tgtataattg

     8521 cgggactcta atcataaaaa cccatctcat aaataacgtc atgcattaca tgttaattat

     8581 tacatgctta acgtaattca acagaaatta tatgataatc atcgcaagac cggcaacagg

     8641 attcaatctt aagaaacttt attgccaaat gtttgaacga tctgcttcga cgcactcctt

     8701 ctttactcca ccatctcgtc cttattgaaa acgtgggtag caccaaaacg aatcaagtcg

     8761 ctggaactga agttaccaat cacgctggat gatttgccag ttggattaat cttgcctttc

     8821 cccgcatgaa taatattgat gaatgcatgc gtgaggggta tttcgatttt ggcaatagct

     8881 gcaattgccg cgacatcctc caacgagcat aattcttcag aaaaatagcg atgttccatg

     8941 ttgtcagggc atgcatgatg cacgttatga ggtgacggtg ctaggcagta ttccctcaaa

     9001 gtttcatagt cagtatcata ttcatcattg cattcctgca agagagaatt gagacgcaat

     9061 ccacacgctg cggcaacctt ccggcgttcg tggtctattt gctcttggac gttgcaaacg

     9121 taagtgttgg atcccggtcg gcatctactc tattcctttg ccctcggacg agtgctgggg

     9181 cgtcggtttc cactatcggc gagtacttct acacagccat cggtccagac ggccgcgctt

     9241 ctgcgggcga tttgtgtacg cccgacagtc ccggctccgg atcggacgat tgcgtcgcat

     9301 cgaccctgcg cccaagctgc atcatcgaaa ttgccgtcaa ccaagctctg atagagttgg

     9361 tcaagaccaa tgcggagcat atacgcccgg agccgcggcg atcctgcaag ctccggatgc

     9421 ctccgctcga agtagcgcgt ctgctgctcc atacaagcca accacggcct ccagaagaag

     9481 atgttggcga cctcgtattg ggaatccccg aacatcgcct cgctccagtc aatgaccgct

     9541 gttatgcggc cattgtccgt caggacattg ttggagccga aatccgcgtg cacgaggtgc

     9601 cggacttcgg ggcagtcctc ggcccaaagc atcagctcat cgagagcctg cgcgacggac

     9661 gcactgacgg tgtcgtccat cacagtttgc cagtgataca catggggatc agcaatcgcg

     9721 catatgaaat cacgccatgt agtgtattga ccgattcctt gcggtccgaa tgggccgaac

     9781 ccgctcgtct ggctaagatc ggccgcagcg atcgcatcca tggcctccgc gaccggctgc

     9841 agaacagcgg gcagttcggt ttcaggcagg tcttgcaacg tgacaccctg tgcacggcgg

     9901 gagatgcaat aggtcaggct ctcgctgaat tccccaatgt caagcacttc cggaatcggg

     9961 agcgcggccg atgcaaagtg ccgataaaca taacgatctt tgtagaaacc atcggcgcag

    10021 ctatttaccc gcaggacata tccacgccct cctacatcga agctgaaagc acgagattct

    10081 tcgccctccg agagctgcat caggtcggag acgctgtcga acttttcgat cagaaacttc

    10141 tcgacagacg tcgcggtgag ttcaggcttt ttcatatcgg ggtcgtcctc tccaaatgaa

    10201 atgaacttcc ttatatagag gaagggtctt gcgaaggata gtgggattgt gcgtcatccc

    10261 ttacgtcagt ggagatatca catcaatcca cttgctttga agacgtggtt ggaacgtctt

    10321 ctttttccac gatgctcctc gtgggtgggg gtccatcttt gggaccactg tcggcagagg

    10381 catcttgaac gatagccttt cctttatcgc aatgatggca tttgtaggtg ccaccttcct

    10441 tttctactgt ccttttgatg aagtgacaga tagctgggca atggaatccg aggaggtttc

    10501 ccgatattac cctttgttga aaagtctcaa tagccctttg gtcttctgag actgtatctt

    10561 tgatattctt ggagtagacg agagtgtcgt gctccaccat gttgacggat ctctaggacg

    10621 cgtcctagaa gctaattcac tggccgtcgt tttacaacgt cgtgactggg aaaaccctgg

    10681 cgttacccaa cttaatcgcc ttgcagcaca tccccctttc gccagctggc gtaatagcga

    10741 agaggcccgc accgatcgcc cttcccaaca gttgcgcagc ctgaatggcg cccgctcctt

    10801 tcgctttctt cccttccttt ctcgccacgt tcgccggctt tccccgtcaa gctctaaatc

    10861 gggggctccc tttagggttc cgatttagtg ctttacggca cctcgacccc aaaaaacttg

    10921 atttgggtga tggttcacgt agtgggccat cgccctgata gacggttttt cgccctttga

    10981 cgttggagtc cacgttcttt aatagtggac tcttgttcca aactggaaca acactcaacc

    11041 ctatctcggg ctattctttt gatttataag ggattttgcc gatttcggaa ccaccatcaa

    11101 acaggatttt cgcctgctgg ggcaaaccag cgtggaccgc ttgctgcaac tctctcaggg

    11161 ccaggcggtg aagggcaatc agctgttgcc cgtctcactg gtgaaaagaa aaaccacccc

    11221 agtacattaa aaacgtccgc aatgtgttat taagttgtct aagcgtcaat ttgtttacac

    11281 cacaatatat cctgccacca gccagccaac agctccccga ccggcagctc ggcacaaaat

    11341 caccactcga tacaggcagc ccatcagtcc gggacggcgt cagcgggaga gccgttgtaa

    11401 ggcggcagac tttgctcatg ttaccgatgc tattcggaag aacggcaact aagctgccgg

    11461 gtttgaaaca cggatgatct cgcggagggt agcatgttga ttgtaacgat gacagagcgt

    11521 tgctgcctgt gatcaaatat catctccctc gcagagatcc gaattatcag ccttcttatt

    11581 catttctcgc ttaaccgtga caggctgtcg atcttgagaa ctatgccgac ataataggaa

    11641 atcgctggat aaagccgctg aggaagctga gtggcgctat ttctttagaa gtgaacgttg

    11701 acgatatcaa ctcccctatc cattgctcac cgaatggtac aggtcgggga cccgaagttc

    11761 cgactgtcgg cctgatgcat ccccggctga tcgaccccag atctggggct gagaaagccc

    11821 agtaaggaaa caactgtagg ttcgagtcgc gagatccccc ggaaccaaag gaagtaggtt

    11881 aaacccgctc cgatcaggcc gagccacgcc aggccgagaa cattggttcc tgtaggcatc

    11941 gggattggcg gatcaaacac taaagctact ggaacgagca gaagtcctcc ggccgccagt

    12001 tgccaggcgg taaaggtgag cagaggcacg ggaggttgcc acttgcgggt cagcacggtt

    12061 ccgaacgcca tggaaaccgc ccccgccagg cccgctgcga cgccgacagg atctagcgct

    12121 gcgtttggtg tcaacaccaa cagcgccacg cccgcagttc cgcaaatagc ccccaggacc

    12181 gccatcaatc gtatcgggct acctagcaga gcggcagaga tgaacacgac catcagcggc

    12241 tgcacagcgc ctaccgtcgc cgcgaccccg cccggcaggc ggtagaccga aataaacaac

    12301 aagctccaga atagcgaaat attaagtgcg ccgaggatga agatgcgcat ccaccagatt

    12361 cccgttggaa tctgtcggac gatcatcacg agcaataaac ccgccggcaa cgcccgcagc

    12421 agcataccgg cgacccctcg gcctcgctgt tcgggctcca cgaaaacgcc ggacagatgc

    12481 gccttgtgag cgtccttggg gccgtcctcc tgtttgaaga ccgacagccc aatgatctcg

    12541 ccgtcgatgt aggcgccgaa tgccacggca tctcgcaacc gttcagcgaa cgcctccatg

    12601 ggctttttct cctcgtgctc gtaaacggac ccgaacatct ctggagcttt cttcagggcc

    12661 gacaatcgga tctcgcggaa atcctgcacg tcggccgctc caagccgtcg aatctgagcc

    12721 ttaatcacaa ttgtcaattt taatcctctg tttatcggca gttcgtagag cgcgccgtgc

    12781 gtcccgagcg atactgagcg aagcaagtgc gtcgagcagt gcccgcttgt tcctgaaatg

    12841 ccagtaaagc gctggctgct gaacccccag ccggaactga ccccacaagg ccctagcgtt

    12901 tgcaatgcac caggtcatca ttgacccagg cgtgttccac caggccgctg cctcgcaact

    12961 cttcgcaggc ttcgccgacc tgctcgcgcc acttcttcac gcgggtggaa tccgatccgc

    13021 acatgaggcg gaaggtttcc agcttgagcg ggtacggctc ccggtgcgag ctgaaatagt

    13081 cgaacatccg tcgggccgtc ggcgacagct tgcggtactt ctcccatatg aatttcgtgt

    13141 agtggtcgcc agcaaacagc acgacgattt cctcgtcgat caggacctgg caacgggacg

    13201 ttttcttgcc acggtccagg acgcggaagc ggtgcagcag cgacaccgat tccaggtgcc

    13261 caacgcggtc ggacgtgaag cccatcgccg tcgcctgtag gcgcgacagg cattcctcgg

    13321 ccttcgtgta ataccggcca ttgatcgacc agcccaggtc ctggcaaagc tcgtagaacg

    13381 tgaaggtgat cggctcgccg ataggggtgc gcttcgcgta ctccaacacc tgctgccaca

    13441 ccagttcgtc atcgtcggcc cgcagctcga cgccggtgta ggtgatcttc acgtccttgt

    13501 tgacgtggaa aatgaccttg ttttgcagcg cctcgcgcgg gattttcttg ttgcgcgtgg

    13561 tgaacagggc agagcgggcc gtgtcgtttg gcatcgctcg catcgtgtcc ggccacggcg

    13621 caatatcgaa caaggaaagc tgcatttcct tgatctgctg cttcgtgtgt ttcagcaacg

    13681 cggcctgctt ggcctcgctg acctgttttg ccaggtcctc gccggcggtt tttcgcttct

    13741 tggtcgtcat agttcctcgc gtgtcgatgg tcatcgactt cgccaaacct gccgcctcct

    13801 gttcgagacg acgcgaacgc tccacggcgg ccgatggcgc gggcagggca gggggagcca

    13861 gttgcacgct gtcgcgctcg atcttggccg tagcttgctg gaccatcgag ccgacggact

    13921 ggaaggtttc gcggggcgca cgcatgacgg tgcggcttgc gatggtttcg gcatcctcgg

    13981 cggaaaaccc cgcgtcgatc agttcttgcc tgtatgcctt ccggtcaaac gtccgattca

    14041 ttcaccctcc ttgcgggatt gccccgactc acgccggggc aatgtgccct tattcctgat

    14101 ttgacccgcc tggtgccttg gtgtccagat aatccacctt atcggcaatg aagtcggtcc

    14161 cgtagaccgt ctggccgtcc ttctcgtact tggtattccg aatcttgccc tgcacgaata

    14221 ccagcgaccc cttgcccaaa tacttgccgt gggcctcggc ctgagagcca aaacacttga

    14281 tgcggaagaa gtcggtgcgc tcctgcttgt cgccggcatc gttgcgccac atctaggtac

    14341 taaaacaatt catccagtaa aatataatat tttattttct cccaatcagg cttgatcccc

    14401 agtaagtcaa aaaatagctc gacatactgt tcttccccga tatcctccct gatcgaccgg

    14461 acgcagaagg caatgtcata ccacttgtcc gccctgccgc ttctcccaag atcaataaag

    14521 ccacttactt tgccatcttt cacaaagatg ttgctgtctc ccaggtcgcc gtgggaaaag

    14581 acaagttcct cttcgggctt ttccgtcttt aaaaaatcat acagctcgcg cggatcttta

    14641 aatggagtgt cttcttccca gttttcgcaa tccacatcgg ccagatcgtt attcagtaag

    14701 taatccaatt cggctaagcg gctgtctaag ctattcgtat agggacaatc cgatatgtcg

    14761 atggagtgaa agagcctgat gcactccgca tacagctcga taatcttttc agggctttgt

    14821 tcatcttcat actcttccga gcaaaggacg ccatcggcct cactcatgag cagattgctc

    14881 cagccatcat gccgttcaaa gtgcaggacc tttggaacag gcagctttcc ttccagccat

    14941 agcatcatgt ccttttcccg ttccacatca taggtggtcc ctttataccg gctgtccgtc

    15001 atttttaaat ataggttttc attttctccc accagcttat ataccttagc aggagacatt

    15061 ccttccgtat cttttacgca gcggtatttt tcgatcagtt ttttcaattc cggtgatatt

    15121 ctcattttag ccatttatta tttccttcct cttttctaca gtatttaaag ataccccaag

    15181 aagctaatta taacaagacg aactccaatt cactgttcct tgcattctaa aaccttaaat

    15241 accagaaaac agctttttca aagttgtttt caaagttggc gtataacata gtatcgacgg

    15301 agccgatttt gaaaccacaa ttatgggtga tgctgccaac ttactgattt agtgtatgat

    15361 ggtgtttttg aggtgctcca gtggcttctg tgtctatcag ctgtccctcc tgttcagcta

    15421 ctgacggggt ggtgcgtaac ggcaaaagca ccgccggaca tcagcgctat ctctgctctc

    15481 actgccgtaa aacatggcaa ctgcagttca cttacaccgc ttctcaaccc ggtacgcacc

    15541 agaaaatcat tgatatggcc atgaatggcg ttggatgccg ggcaacagcc cgcattatgg

    15601 gcgttggcct caacacgatt ttacgtcact taaaaaactc aggccgcagt cggtaacctc

    15661 gcgcatacag ccgggcagtg acgtcatcgt ctgcgcggaa atggacgaac agtggggcta

    15721 tgtcggggct aaatcgcgcc agcgctggct gttttacgcg tatgacagtc tccggaagac

    15781 ggttgttgcg cacgtattcg gtgaacgcac tatggcgacg ctggggcgtc ttatgagcct

    15841 gctgtcaccc tttgacgtgg tgatatggat gacggatggc tggccgctgt atgaatcccg

    15901 cctgaaggga aagctgcacg taatcagcaa gcgatatacg cagcgaattg agcggcataa

    15961 cctgaatctg aggcagcacc tggcacggct gggacggaag tcgctgtcgt tctcaaaatc

    16021 ggtggagctg catgacaaag tcatcgggca ttatctgaac ataaaacact atcaataagt

    16081 tggagtcatt acccaattat gatagaattt acaagctata aggttattgt cctgggtttc

    16141 aagcattagt ccatgcaagt ttttatgctt tgcccattct atagatatat tgataagcgc

    16201 gctgcctatg ccttgccccc tgaaatcctt acatacggcg atatcttcta tataaaagat

    16261 atattatctt atcagtattg tcaatatatt caaggcaatc tgcctcctca tcctcttcat

    16321 cctcttcgtc ttggtagctt tttaaatatg gcgcttcata gagtaattct gtaaaggtcc

    16381 aattctcgtt ttcatacctc ggtataatct tacctatcac ctcaaatggt tcgctgggtt

    16441 tatcgcaccc ccgaacacga gcacggcacc cgcgaccact atgccaagaa tgcccaaggt

    16501 aaaaattgcc ggccccgcca tgaagtccgt gaatgccccg acggccgaag tgaagggcag

    16561 gccgccaccc aggccgccgc cctcactgcc cggcacctgg tcgctgaatg tcgatgccag

    16621 cacctgcggc acgtcaatgc ttccgggcgt cgcgctcggg ctgatcgccc atcccgttac

    16681 tgccccgatc ccggcaatgg caaggactgc cagcgctgcc atttttgggg tgaggccgtt

    16741 cgcggccgag gggcgcagcc cctgggggga tgggaggccc gcgttagcgg gccgggaggg

    16801 ttcgagaagg gggggcaccc cccttcggcg tgcgcggtca cgcgcacagg gcgcagccct

    16861 ggttaaaaac aaggtttata aatattggtt taaaagcagg ttaaaagaca ggttagcggt

    16921 ggccgaaaaa cgggcggaaa cccttgcaaa tgctggattt tctgcctgtg gacagcccct

    16981 caaatgtcaa taggtgcgcc cctcatctgt cagcactctg cccctcaagt gtcaaggatc

    17041 gcgcccctca tctgtcagta gtcgcgcccc tcaagtgtca ataccgcagg gcacttatcc

    17101 ccaggcttgt ccacatcatc tgtgggaaac tcgcgtaaaa tcaggcgttt tcgccgattt

    17161 gcgaggctgg ccagctccac gtcgccggcc gaaatcgagc ctgcccctca tctgtcaacg

    17221 ccgcgccggg tgagtcggcc cctcaagtgt caacgtccgc ccctcatctg tcagtgaggg

    17281 ccaagttttc cgcgaggtat ccacaacgcc ggcggccgcg gtgtctcgca cacggcttcg

    17341 acggcgtttc tggcgcgttt gcagggccat agacggccgc cagcccagcg gcgagggcaa

    17401 ccagcccgg

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart