pGWB4

$260.00

  • Model: PVT11149
  • 50 Units in Stock
Ask a question


Add to Cart:

pGWB4


Catalog No. PVT11149
Packing 2ug

 

pGWB4 Informaiton
Function plant expression plasmid
Resistance Kan
Screen Hyg/Neo/G418
Strain DB3.1
Culture temperature 37degrees centigrade

 

pGWB4 Description

PGWB4 is a plant expression plasmid.

 

pGWB4 Sequence

LOCUS       Exported               17102 bp ds-DNA     circular SYN 25-JAN-2018

FEATURES             Location/Qualifiers

     source          1..17102

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             complement(145..516)

                     /codon_start=1

                     /gene="traJ"

                     /product="oriT-recognizing protein"

                     /label=traJ

                     /translation="MADETKPTRKGSPPIKVYCLPDERRAIEEKAAAAGMSLSAYLLAV

                     GQGYKITGVVDYEHVRELARINGDLGRLGGLLKLWLTDDPRTARFGDATILALLAKIEE

                     KQDELGKVMMGVVRPRAEP"

     oriT            549..658

                     /note="incP origin of transfer"

     CDS             complement(1339..1989)

                     /codon_start=1

                     /gene="tetR"

                     /product="tetracycline resistance regulatory protein"

                     /label=TetR

                     /translation="MTKLQPNTVIRAALDLLNEVGVDGLTTRKLAERLGVQQPALYWHF

                     RNKRALLDALAEAMLAENHTHSVPRADDDWRSFLIGNARSFRQALLAYRDGARIHAGTR

                     PGAPQMETADAQLRFLCEAGFSAGDAVNALMTISYFTVGAVLEEQAGDSDAGERGGTVE

                     QAPLSPLLRAAIDAFDEAGPDAAFEQGLAVIVDGLAKRRLVVRNVEGPRKGDD"

     misc_feature    2454..2478

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        2634..2817

                     /function="NOS promoter"

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     CDS             2838..3632

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=Neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     terminator      4022..4274

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     protein_bind    4977..5101

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        5138..5168

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             5222..5881

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             6223..6528

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(6569..6693)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             6698..7417

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITHGMDELYK"

     terminator      7442..7694

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     terminator      8123..8375

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(8843..9868)

                     /codon_start=1

                     /gene="aph(4)-Ia"

                     /product="aminoglycoside phosphotransferase from E. coli"

                     /label=HygR

                     /note="confers resistance to hygromycin"

                     /translation="MKKPELTATSVEKFLIEKFDSVSDLMQLSEGEESRAFSFDVGGRG

                     YVLRVNSCADGFYKDRYVYRHFASAALPIPEVLDIGEFSESLTYCISRRAQGVTLQDLP

                     ETELPAVLQPVAEAMDAIAAADLSQTSGFGPFGPQGIGQYTTWRDFICAIADPHVYHWQ

                     TVMDDTVSASVAQALDELMLWAEDCPEVRHLVHADFGSNNVLTDNGRITAVIDWSEAMF

                     GDSQYEVANIFFWRPWLACMEQQTRYFERRHPELAGSPRLRAYMLRIGLDQLYQSLVDG

                     NFDDAAWAQGRCDAIVRSGAGTVGRTQIARRSAAVWTDGCVEVLADSGNRRPSTRPRAK

                     E"

     promoter        complement(9878..10222)

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     misc_feature    10966..10990

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             complement(12586..13734)

                     /codon_start=1

                     /product="trans-acting replication protein that binds to 

                     and activates oriV"

                     /label=trfA

                     /translation="MNRTFDRKAYRQELIDAGFSAEDAETIASRTVMRAPRETFQSVGS

                     MVQQATAKIERDSVQLAPPALPAPSAAVERSRRLEQEAAGLAKSMTIDTRGTMTTKKRK

                     TAGEDLAKQVSEAKQAALLKHTKQQIKEMQLSLFDIAPWPDTMRAMPNDTARSALFTTR

                     NKKIPREALQNKVIFHVNKDVKITYTGVELRADDDELVWQQVLEYAKRTPIGEPITFTF

                     YELCQDLGWSINGRYYTKAEECLSRLQATAMGFTSDRVGHLESVSLLHRFRVLDRGKKT

                     SRCQVLIDEEIVVLFAGDHYTKFIWEKYRKLSPTARRMFDYFSSHREPYPLKLETFRLM

                     CGSDSTRVKKWREQVGEACEELRGSGLVEHAWVNDDLVHCKR"

     CDS             complement(14033..14827)

                     /codon_start=1

                     /gene="aphA-3"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin"

                     /translation="MAKMRISPELKKLIEKYRCVKDTEGMSPAKVYKLVGENENLYLKM

                     TDSRYKGTTYDVEREKDMMLWLEGKLPVPKVLHFERHDGWSNLLMSEADGVLCSEEYED

                     EQSPEKIIELYAECIRLFHSIDISDCPYTNSLDSRLAELDYLLNNDLADVDCENWEEDT

                     PFKDPRELYDFLKTEKPEEELVFSHGDLGDSNIFVKDGKVSGFIDLGRSGRADKWYDIA

                     FCVRSIREDIGEEQYVELFFDLLGIKPDWEKIKYYILLDELF"

     mobile_element  15019..15786

                     /mobile_element_type="insertion sequence:IS1"

                     /note="prokaryotic transposable element"

     rep_origin      16409..18

                     /label=oriV

                     /note="incP origin of replication"

ORIGIN

        1 tgagcgtcgc aaaggcgctc ggtcttgcct tgctcgtcgg tgatgtactt caccagctcc

       61 gcgaagtcgc tcttcttgat ggagcgcatg gggacgtgct tggcaatcac gcgcaccccc

      121 cggccgtttt agcggctaaa aaagtcatgg ctctgccctc gggcggacca cgcccatcat

      181 gaccttgcca agctcgtcct gcttctcttc gatcttcgcc agcagggcga ggatcgtggc

      241 atcaccgaac cgcgccgtgc gcgggtcgtc ggtgagccag agtttcagca ggccgcccag

      301 gcggcccagg tcgccattga tgcgggccag ctcgcggacg tgctcatagt ccacgacgcc

      361 cgtgattttg tagccctggc cgacggccag caggtaggcc gacaggctca tgccggccgc

      421 cgccgccttt tcctcaatcg ctcttcgttc gtctggaagg cagtacacct tgataggtgg

      481 gctgcccttc ctggttggct tggtttcatc agccatccgc ttgccctcat ctgttacgcc

      541 ggcggtagcc ggccagcctc gcagagcagg attcccgttg agcaccgcca ggtgcgaata

      601 agggacagtg aagaaggaac acccgctcgc gggtgggcct acttcaccta tcctgcccgg

      661 ctgacgccgt tggatacacc aaggaaagtc tacacgaacc ctttggcaaa atcctgtata

      721 tcgtgcgaaa aaggatggat ataccgaaaa aatcgctata atgaccccga agcagggtta

      781 tgcagcggaa aagcgccacg cttcccgaag ggagaaaggc ggacaggtat ccggtaagcg

      841 gcagggtcgg aacaggagag cgcacgaggg agcttccagg gggaaacgcc tggtatcttt

      901 atagtcctgt cgggtttcgc cacctctgac ttgagcgtcg atttttgtga tgctcgtcag

      961 gggggcggag cctatggaaa aacgccagca acgcggcctt tttacggttc ctggcctttt

     1021 gctggccttt tgctcacatg ttctttcctg cgttatcccc tgattctgtg gataaccgta

     1081 ttaccgcctt tgagtgagct gataccgctc gccgcagccg aacgaccgag cgcagcgagt

     1141 cagtgagcga ggaagcggaa gagcgccaga aggccgccag agaggccgag cgcggccgtg

     1201 aggcttggac gctagggcag ggcatgaaaa agcccgtagc gggctgctac gggcgtctga

     1261 cgcggtggaa agggggaggg gatgttgtct acatggctct gctgtagtga gtgggttgcg

     1321 ctccggcagc ggtcctgatc aatcgtcacc ctttctcggt ccttcaacgt tcctgacaac

     1381 gagcctcctt ttcgccaatc catcgacaat caccgcgagt ccctgctcga acgctgcgtc

     1441 cggaccggct tcgtcgaagg cgtctatcgc ggcccgcaac agcggcgaga gcggagcctg

     1501 ttcaacggtg ccgccgcgct cgccggcatc gctgtcgccg gcctgctcct caagcacggc

     1561 cccaacagtg aagtagctga ttgtcatcag cgcattgacg gcgtccccgg ccgaaaaacc

     1621 cgcctcgcag aggaagcgaa gctgcgcgtc ggccgtttcc atctgcggtg cgcccggtcg

     1681 cgtgccggca tggatgcgcg cgccatcgcg gtaggcgagc agcgcctgcc tgaagctgcg

     1741 ggcattcccg atcagaaatg agcgccagtc gtcgtcggct ctcggcaccg aatgcgtatg

     1801 attctccgcc agcatggctt cggccagtgc gtcgagcagc gcccgcttgt tcctgaagtg

     1861 ccagtaaagc gccggctgct gaacccccaa ccgttccgcc agtttgcgtg tcgtcagacc

     1921 gtctacgccg acctcgttca acaggtccag ggcggcacgg atcactgtat tcggctgcaa

     1981 ctttgtcatg cttgacactt tatcactgat aaacataata tgtccaccaa cttatcagtg

     2041 ataaagaatc cgcgcgttca atcggaccag cggaggctgg tccggaggcc agacgtgaaa

     2101 cccaacatac ccctgatcgt aattctgagc actgtcgcgc tcgacgctgt cggcatcggc

     2161 ctgattatgc cggtgctgcc gggcctcctg cgcgatctgg ttcactcgaa cgacgtcacc

     2221 gcccactatg gcattctgct ggcgctgtat gcgttggtgc aatttgcctg cgcacctgtg

     2281 ctgggcgcgc tgtcggatcg tttcgggcgg cggccaatct tgctcgtctc gctggccggc

     2341 gccagatctg gggaaccctg tggttggcat gcacatacaa atggacgaac ggataaacct

     2401 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

     2461 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

     2521 tcatgagcgg agaattaagg gagtcacgtt atgacccccg ccgatgacgc gggacaagcc

     2581 gttttacgtt tggaactgac agaaccgcaa cgttgaagga gccactcagc cgcgggtttc

     2641 tggagtttaa tgagctaagc acatacgtca gaaaccatta ttgcgcgttc aaaagtcgcc

     2701 taaggtcact atcagctagc aaatatttct tgtcaaaaat gctccactga cgttccataa

     2761 attcccctcg gtatccaatt agagtctcat attcactctc aatccaaata atctgcaccg

     2821 gatctggatc gtttcgcatg attgaacaag atggattgca cgcaggttct ccggccgctt

     2881 gggtggagag gctattcggc tatgactggg cacaacagac aatcggctgc tctgatgccg

     2941 ccgtgttccg gctgtcagcg caggggcgcc cggttctttt tgtcaagacc gacctgtccg

     3001 gtgccctgaa tgaactgcag gacgaggcag cgcggctatc gtggctggcc acgacgggcg

     3061 ttccttgcgc agctgtgctc gacgttgtca ctgaagcggg aagggactgg ctgctattgg

     3121 gcgaagtgcc ggggcaggat ctcctgtcat ctcaccttgc tcctgccgag aaagtatcca

     3181 tcatggctga tgcaatgcgg cggctgcata cgcttgatcc ggctacctgc ccattcgacc

     3241 accaagcgaa acatcgcatc gagcgagcac gtactcggat ggaagccggt cttgtcgatc

     3301 aggatgatct ggacgaagag catcaggggc tcgcgccagc cgaactgttc gccaggctca

     3361 aggcgcgcat gcccgacggc gatgatctcg tcgtgaccca tggcgatgcc tgcttgccga

     3421 atatcatggt ggaaaatggc cgcttttctg gattcatcga ctgtggccgg ctgggtgtgg

     3481 cggaccgcta tcaggacata gcgttggcta cccgtgatat tgctgaagag cttggcggcg

     3541 aatgggctga ccgcttcctc gtgctttacg gtatcgccgc tcccgattcg cagcgcatcg

     3601 ccttctatcg ccttcttgac gagttcttct gagcgggact ctggggttcg aaatgaccga

     3661 ccaagcgacg cccaacctgc catcacgaga tttcgattcc accgccgcct tctatgaaag

     3721 gttgggcttc ggaatcgttt tccgggacgc cggctggatg atcctccagc gcggggatct

     3781 catgctggag ttcttcgccc acgggatctc tgcggaacag gcggtcgaag gtgccgatat

     3841 cattacgaca gcaacggccg acaagcacaa cgccacgatc ctgagcgaca atatgatcgg

     3901 gcccggcgtc cacatcaacg gcgtcggcgg cgactgccca ggcaagaccg agatgcaccg

     3961 cgatatcttg ctgcgttcgg atattttcgt ggagttcccg ccacagaccc ggatgatccc

     4021 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     4081 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     4141 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     4201 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     4261 tatgttacta gatcgggcct cctgtcaatg ctggcggcgg ctctggtggt ggttctggtg

     4321 gcggctctga gggtggtggc tctgagggtg gcggttctga gggtggcggc tctgagggag

     4381 gcggttccgg tggtggctct ggttccggtg attttgatta tgaaaagatg gcaaacgcta

     4441 ataagggggc tatgaccgaa aatgccgatg aaaacgcgct acagtctgac gctaaaggca

     4501 aacttgattc tgtcgctact gattacggtg ctgctatcga tggtttcatt ggtgacgttt

     4561 ccggccttgc taatggtaat ggtgctactg gtgattttgc tggctctaat tcccaaatgg

     4621 ctcaagtcgg tgacggtgat aattcacctt taatgaataa tttccgtcaa tatttacctt

     4681 ccctccctca atcggttgaa tgtcgccctt ttgtctttgg cccaatacgc aaaccgcctc

     4741 tccccgcgcg ttggccgatt cattaatgca gctggcacga caggtttccc gactggaaag

     4801 cgggcagtga gcgcaacgca attaatgtga gttagctcac tcattaggca ccccaggctt

     4861 tacactttat gcttccggct cgtatgttgt gtggaattgt gagcggataa caatttcaca

     4921 caggaaacag ctatgaccat gattacgcca agcttgcatg cctgcaggct ctaatcacaa

     4981 gtttgtacaa aaaagctgaa cgagaaacgt aaaatgatat aaatatcaat atattaaatt

     5041 agattttgca taaaaaacag actacataat actgtaaaac acaacatatc cagtcactat

     5101 ggcggcccct cgaggggccg cattaggcac cccaggcttt acactttatg cttccggctc

     5161 gtataatgtg tggattttga gttaggatcc ggcgagattt tcaggagcta aggaagctaa

     5221 aatggagaaa aaaatcactg gatataccac cgttgatata tcccaatggc atcgtaaaga

     5281 acattttgag gcatttcagt cagttgctca atgtacctat aaccagaccg ttcagctgga

     5341 tattacggcc tttttaaaga ccgtaaagaa aaataagcac aagttttatc cggcctttat

     5401 tcacattctt gcccgcctga tgaatgctca tccggaattc cgtatggcaa tgaaagacgg

     5461 tgagctggtg atatgggata gtgttcaccc ttgttacacc gttttccatg agcaaactga

     5521 aacgttttca tcgctctgga gtgaatacca cgacgatttc cggcagtttc tacacatata

     5581 ttcgcaagat gtggcgtgtt acggtgaaaa cctggcctat ttccctaaag ggtttattga

     5641 gaatatgttt ttcgtctcag ccaatccctg ggtgagtttc accagttttg atttaaacgt

     5701 ggccaatatg gacaacttct tcgcccccgt tttcaccatg ggcaaatatt atacgcaagg

     5761 cgacaaggtg ctgatgccgc tggcgattca ggttcatcat gccgtctgtg atggcttcca

     5821 tgtcggcaga atgcttaatg aattacaaca gtactgcgat gagtggcagg gcggggcgta

     5881 aacgcgtgga tccggcttac taaaagccag ataacagtat gcgtatttgc gcgctgattt

     5941 ttgcggtata agaatatata ctgatatgta tacccgaagt atgtcaaaaa gaggtgtgct

     6001 atgaagcagc gtattacagt gacagttgac agcgacagct atcagttgct caaggcatat

     6061 atgatgtcaa tatctccggt ctggtaagca caaccatgca gaatgaagcc cgtcgtctgc

     6121 gtgccgaacg ctggaaagcg gaaaatcagg aagggatggc tgaggtcgcc cggtttattg

     6181 aaatgaacgg ctcttttgct gacgagaaca gggactggtg aaatgcagtt taaggtttac

     6241 acctataaaa gagagagccg ttatcgtctg tttgtggatg tacagagtga tattattgac

     6301 acgcccgggc gacggatggt gatccccctg gccagtgcac gtctgctgtc agataaagtc

     6361 tcccgtgaac tttacccggt ggtgcatatc ggggatgaaa gctggcgcat gatgaccacc

     6421 gatatggcca gtgtgccggt ctccgttatc ggggaagaag tggctgatct cagccaccgc

     6481 gaaaatgaca tcaaaaacgc cattaacctg atgttctggg gaatataaat gtcaggctcc

     6541 cttatacaca gccagtctgc aggtcgacca tagtgactgg atatgttgtg ttttacagta

     6601 ttatgtagtc tgttttttat gcaaaatcta atttaatata ttgatattta tatcatttta

     6661 cgtttctcgt tcagctttct tgtacaaagt ggtgatcatg gtgagcaagg gcgaggagct

     6721 gttcaccggg gtggtgccca tcctggtcga gctggacggc gacgtgaacg gccacaagtt

     6781 cagcgtgtcc ggcgagggcg agggcgatgc cacctacggc aagctgaccc tgaagttcat

     6841 ctgcaccacc ggcaagctgc ccgtgccctg gcccaccctc gtgaccacct tcacctacgg

     6901 cgtgcagtgc ttcagccgct accccgacca catgaagcag cacgacttct tcaagtccgc

     6961 catgcccgaa ggctacgtcc aggagcgcac catcttcttc aaggacgacg gcaactacaa

     7021 gacccgcgcc gaggtgaagt tcgagggcga caccctggtg aaccgcatcg agctgaaggg

     7081 catcgacttc aaggaggacg gcaacatcct ggggcacaag ctggagtaca actacaacag

     7141 ccacaacgtc tatatcatgg ccgacaagca gaagaacggc atcaaggtga acttcaagat

     7201 ccgccacaac atcgaggacg gcagcgtgca gctcgccgac cactaccagc agaacacccc

     7261 catcggcgac ggccccgtgc tgctgcccga caaccactac ctgagcaccc agtccgccct

     7321 gagcaaagac cccaacgaga agcgcgatca catggtcctg ctggagttcg tgaccgccgc

     7381 cgggatcact cacggcatgg acgagctgta caagtaaagc ggcccgagct cgaatttccc

     7441 cgatcgttca aacatttggc aataaagttt cttaagattg aatcctgttg ccggtcttgc

     7501 gatgattatc atataatttc tgttgaatta cgttaagcat gtaataatta acatgtaatg

     7561 catgacgtta tttatgagat gggtttttat gattagagtc ccgcaattat acatttaata

     7621 cgcgatagaa aacaaaatat agcgcgcaaa ctaggataaa ttatcgcgcg cggtgtcatc

     7681 tatgttacta gatcgggaat tagcttcatc aacgcaagac atgcgcacga ccgtctgaca

     7741 ggagaggaat ttccgacgag cacagaaagg acttgctctt ggacgtaggc ctatttctca

     7801 ggcacatgta tcaagtgttc ggacgtgggt tttcgatggt gtatcagccg ccgccaactg

     7861 ggagatgagg aggctttctt ggggggcagt cagcagttca tttcacaaga cagaggaact

     7921 tgtaaggaga tgcactgatt tatcttggcg caaaccagca ggacgaatta gtgggaatag

     7981 cccgcgaata tctaagttat gcctgtcggc atgagcagaa acttccaatt cgaaacagtt

     8041 tggagaggtt gtttttgggc ataccttttg ttagtcagcc tctcgattgc tcatcgtcat

     8101 tacacagtac cgaagtttga tcgatctagt aacatagatg acaccgcgcg cgataattta

     8161 tcctagtttg cgcgctatat tttgttttct atcgcgtatt aaatgtataa ttgcgggact

     8221 ctaatcataa aaacccatct cataaataac gtcatgcatt acatgttaat tattacatgc

     8281 ttaacgtaat tcaacagaaa ttatatgata atcatcgcaa gaccggcaac aggattcaat

     8341 cttaagaaac tttattgcca aatgtttgaa cgatctgctt cgacgcactc cttctttact

     8401 ccaccatctc gtccttattg aaaacgtggg tagcaccaaa acgaatcaag tcgctggaac

     8461 tgaagttacc aatcacgctg gatgatttgc cagttggatt aatcttgcct ttccccgcat

     8521 gaataatatt gatgaatgca tgcgtgaggg gtatttcgat tttggcaata gctgcaattg

     8581 ccgcgacatc ctccaacgag cataattctt cagaaaaata gcgatgttcc atgttgtcag

     8641 ggcatgcatg atgcacgtta tgaggtgacg gtgctaggca gtattccctc aaagtttcat

     8701 agtcagtatc atattcatca ttgcattcct gcaagagaga attgagacgc aatccacacg

     8761 ctgcggcaac cttccggcgt tcgtggtcta tttgctcttg gacgttgcaa acgtaagtgt

     8821 tggatcccgg tcggcatcta ctctattcct ttgccctcgg acgagtgctg gggcgtcggt

     8881 ttccactatc ggcgagtact tctacacagc catcggtcca gacggccgcg cttctgcggg

     8941 cgatttgtgt acgcccgaca gtcccggctc cggatcggac gattgcgtcg catcgaccct

     9001 gcgcccaagc tgcatcatcg aaattgccgt caaccaagct ctgatagagt tggtcaagac

     9061 caatgcggag catatacgcc cggagccgcg gcgatcctgc aagctccgga tgcctccgct

     9121 cgaagtagcg cgtctgctgc tccatacaag ccaaccacgg cctccagaag aagatgttgg

     9181 cgacctcgta ttgggaatcc ccgaacatcg cctcgctcca gtcaatgacc gctgttatgc

     9241 ggccattgtc cgtcaggaca ttgttggagc cgaaatccgc gtgcacgagg tgccggactt

     9301 cggggcagtc ctcggcccaa agcatcagct catcgagagc ctgcgcgacg gacgcactga

     9361 cggtgtcgtc catcacagtt tgccagtgat acacatgggg atcagcaatc gcgcatatga

     9421 aatcacgcca tgtagtgtat tgaccgattc cttgcggtcc gaatgggccg aacccgctcg

     9481 tctggctaag atcggccgca gcgatcgcat ccatggcctc cgcgaccggc tgcagaacag

     9541 cgggcagttc ggtttcaggc aggtcttgca acgtgacacc ctgtgcacgg cgggagatgc

     9601 aataggtcag gctctcgctg aattccccaa tgtcaagcac ttccggaatc gggagcgcgg

     9661 ccgatgcaaa gtgccgataa acataacgat ctttgtagaa accatcggcg cagctattta

     9721 cccgcaggac atatccacgc cctcctacat cgaagctgaa agcacgagat tcttcgccct

     9781 ccgagagctg catcaggtcg gagacgctgt cgaacttttc gatcagaaac ttctcgacag

     9841 acgtcgcggt gagttcaggc tttttcatat cggggtcgtc ctctccaaat gaaatgaact

     9901 tccttatata gaggaagggt cttgcgaagg atagtgggat tgtgcgtcat cccttacgtc

     9961 agtggagata tcacatcaat ccacttgctt tgaagacgtg gttggaacgt cttctttttc

    10021 cacgatgctc ctcgtgggtg ggggtccatc tttgggacca ctgtcggcag aggcatcttg

    10081 aacgatagcc tttcctttat cgcaatgatg gcatttgtag gtgccacctt ccttttctac

    10141 tgtccttttg atgaagtgac agatagctgg gcaatggaat ccgaggaggt ttcccgatat

    10201 taccctttgt tgaaaagtct caatagccct ttggtcttct gagactgtat ctttgatatt

    10261 cttggagtag acgagagtgt cgtgctccac catgttgacg gatctctagg acgcgtccta

    10321 gaagctaatt cactggccgt cgttttacaa cgtcgtgact gggaaaaccc tggcgttacc

    10381 caacttaatc gccttgcagc acatccccct ttcgccagct ggcgtaatag cgaagaggcc

    10441 cgcaccgatc gcccttccca acagttgcgc agcctgaatg gcgcccgctc ctttcgcttt

    10501 cttcccttcc tttctcgcca cgttcgccgg ctttccccgt caagctctaa atcgggggct

    10561 ccctttaggg ttccgattta gtgctttacg gcacctcgac cccaaaaaac ttgatttggg

    10621 tgatggttca cgtagtgggc catcgccctg atagacggtt tttcgccctt tgacgttgga

    10681 gtccacgttc tttaatagtg gactcttgtt ccaaactgga acaacactca accctatctc

    10741 gggctattct tttgatttat aagggatttt gccgatttcg gaaccaccat caaacaggat

    10801 tttcgcctgc tggggcaaac cagcgtggac cgcttgctgc aactctctca gggccaggcg

    10861 gtgaagggca atcagctgtt gcccgtctca ctggtgaaaa gaaaaaccac cccagtacat

    10921 taaaaacgtc cgcaatgtgt tattaagttg tctaagcgtc aatttgttta caccacaata

    10981 tatcctgcca ccagccagcc aacagctccc cgaccggcag ctcggcacaa aatcaccact

    11041 cgatacaggc agcccatcag tccgggacgg cgtcagcggg agagccgttg taaggcggca

    11101 gactttgctc atgttaccga tgctattcgg aagaacggca actaagctgc cgggtttgaa

    11161 acacggatga tctcgcggag ggtagcatgt tgattgtaac gatgacagag cgttgctgcc

    11221 tgtgatcaaa tatcatctcc ctcgcagaga tccgaattat cagccttctt attcatttct

    11281 cgcttaaccg tgacaggctg tcgatcttga gaactatgcc gacataatag gaaatcgctg

    11341 gataaagccg ctgaggaagc tgagtggcgc tatttcttta gaagtgaacg ttgacgatat

    11401 caactcccct atccattgct caccgaatgg tacaggtcgg ggacccgaag ttccgactgt

    11461 cggcctgatg catccccggc tgatcgaccc cagatctggg gctgagaaag cccagtaagg

    11521 aaacaactgt aggttcgagt cgcgagatcc cccggaacca aaggaagtag gttaaacccg

    11581 ctccgatcag gccgagccac gccaggccga gaacattggt tcctgtaggc atcgggattg

    11641 gcggatcaaa cactaaagct actggaacga gcagaagtcc tccggccgcc agttgccagg

    11701 cggtaaaggt gagcagaggc acgggaggtt gccacttgcg ggtcagcacg gttccgaacg

    11761 ccatggaaac cgcccccgcc aggcccgctg cgacgccgac aggatctagc gctgcgtttg

    11821 gtgtcaacac caacagcgcc acgcccgcag ttccgcaaat agcccccagg accgccatca

    11881 atcgtatcgg gctacctagc agagcggcag agatgaacac gaccatcagc ggctgcacag

    11941 cgcctaccgt cgccgcgacc ccgcccggca ggcggtagac cgaaataaac aacaagctcc

    12001 agaatagcga aatattaagt gcgccgagga tgaagatgcg catccaccag attcccgttg

    12061 gaatctgtcg gacgatcatc acgagcaata aacccgccgg caacgcccgc agcagcatac

    12121 cggcgacccc tcggcctcgc tgttcgggct ccacgaaaac gccggacaga tgcgccttgt

    12181 gagcgtcctt ggggccgtcc tcctgtttga agaccgacag cccaatgatc tcgccgtcga

    12241 tgtaggcgcc gaatgccacg gcatctcgca accgttcagc gaacgcctcc atgggctttt

    12301 tctcctcgtg ctcgtaaacg gacccgaaca tctctggagc tttcttcagg gccgacaatc

    12361 ggatctcgcg gaaatcctgc acgtcggccg ctccaagccg tcgaatctga gccttaatca

    12421 caattgtcaa ttttaatcct ctgtttatcg gcagttcgta gagcgcgccg tgcgtcccga

    12481 gcgatactga gcgaagcaag tgcgtcgagc agtgcccgct tgttcctgaa atgccagtaa

    12541 agcgctggct gctgaacccc cagccggaac tgaccccaca aggccctagc gtttgcaatg

    12601 caccaggtca tcattgaccc aggcgtgttc caccaggccg ctgcctcgca actcttcgca

    12661 ggcttcgccg acctgctcgc gccacttctt cacgcgggtg gaatccgatc cgcacatgag

    12721 gcggaaggtt tccagcttga gcgggtacgg ctcccggtgc gagctgaaat agtcgaacat

    12781 ccgtcgggcc gtcggcgaca gcttgcggta cttctcccat atgaatttcg tgtagtggtc

    12841 gccagcaaac agcacgacga tttcctcgtc gatcaggacc tggcaacggg acgttttctt

    12901 gccacggtcc aggacgcgga agcggtgcag cagcgacacc gattccaggt gcccaacgcg

    12961 gtcggacgtg aagcccatcg ccgtcgcctg taggcgcgac aggcattcct cggccttcgt

    13021 gtaataccgg ccattgatcg accagcccag gtcctggcaa agctcgtaga acgtgaaggt

    13081 gatcggctcg ccgatagggg tgcgcttcgc gtactccaac acctgctgcc acaccagttc

    13141 gtcatcgtcg gcccgcagct cgacgccggt gtaggtgatc ttcacgtcct tgttgacgtg

    13201 gaaaatgacc ttgttttgca gcgcctcgcg cgggattttc ttgttgcgcg tggtgaacag

    13261 ggcagagcgg gccgtgtcgt ttggcatcgc tcgcatcgtg tccggccacg gcgcaatatc

    13321 gaacaaggaa agctgcattt ccttgatctg ctgcttcgtg tgtttcagca acgcggcctg

    13381 cttggcctcg ctgacctgtt ttgccaggtc ctcgccggcg gtttttcgct tcttggtcgt

    13441 catagttcct cgcgtgtcga tggtcatcga cttcgccaaa cctgccgcct cctgttcgag

    13501 acgacgcgaa cgctccacgg cggccgatgg cgcgggcagg gcagggggag ccagttgcac

    13561 gctgtcgcgc tcgatcttgg ccgtagcttg ctggaccatc gagccgacgg actggaaggt

    13621 ttcgcggggc gcacgcatga cggtgcggct tgcgatggtt tcggcatcct cggcggaaaa

    13681 ccccgcgtcg atcagttctt gcctgtatgc cttccggtca aacgtccgat tcattcaccc

    13741 tccttgcggg attgccccga ctcacgccgg ggcaatgtgc ccttattcct gatttgaccc

    13801 gcctggtgcc ttggtgtcca gataatccac cttatcggca atgaagtcgg tcccgtagac

    13861 cgtctggccg tccttctcgt acttggtatt ccgaatcttg ccctgcacga ataccagcga

    13921 ccccttgccc aaatacttgc cgtgggcctc ggcctgagag ccaaaacact tgatgcggaa

    13981 gaagtcggtg cgctcctgct tgtcgccggc atcgttgcgc cacatctagg tactaaaaca

    14041 attcatccag taaaatataa tattttattt tctcccaatc aggcttgatc cccagtaagt

    14101 caaaaaatag ctcgacatac tgttcttccc cgatatcctc cctgatcgac cggacgcaga

    14161 aggcaatgtc ataccacttg tccgccctgc cgcttctccc aagatcaata aagccactta

    14221 ctttgccatc tttcacaaag atgttgctgt ctcccaggtc gccgtgggaa aagacaagtt

    14281 cctcttcggg cttttccgtc tttaaaaaat catacagctc gcgcggatct ttaaatggag

    14341 tgtcttcttc ccagttttcg caatccacat cggccagatc gttattcagt aagtaatcca

    14401 attcggctaa gcggctgtct aagctattcg tatagggaca atccgatatg tcgatggagt

    14461 gaaagagcct gatgcac

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart