pGWB455

$193.00

  • Model: PVT11155
  • 50 Units in Stock
Ask a question


Add to Cart:

pGWB455


Catalog No. PVT11155
Packing 2ug

 

pGWB455 Information
Function plant expression plasmid
Resistance Spe
Screen Neo/G418
Strain DB3.1
Culture temperature 37degrees centigrade
Replicon pVS1
Copy Low
Promoter 35s
Induction
Forward primer
Reverse primer

 

pGWB455 Description

PGWB455 is a plant Gateway system expression plasmid. 

 

pGWB455 Sequence

LOCUS       Exported               12362 bp ds-DNA     circular SYN 07-DEC-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..12362

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    54..78

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     promoter        812..1157

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     CDS             1178..1852

                     /codon_start=1

                     /product="monomeric derivative of DsRed (Campbell et al., 

                     2002)"

                     /label=mRFP1

                     /note="mammalian codon-optimized"

                     /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK

                     LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV

                     VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM

                     RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS

                     TGA"

     protein_bind    1862..1986

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        2023..2053

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             2107..2766

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=Chl

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             3108..3413

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /label=ccdB

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(3454..3578)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     terminator      3604..3856

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(4680..5474)

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=Neo

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGDDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     promoter        complement(5495..5710)

                     /function="NOS promoter"

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

     misc_feature    5884..5908

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     CDS             6429..7220

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /label=Spe

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"

     rep_origin      7466..8054

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     misc_feature    8240..8380

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      8724..8918

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     CDS             complement(8984..10057)

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="MSGRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESW

                     QAAADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLS

                     KRDRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKP

                     GRVFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGE

                     ALISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYR

                     LARRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPI

                     LVMRYRNLIEGEASAGS"

     CDS             complement(10486..11115)

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

ORIGIN

        1 tttcacgccc ttttaaatat ccgattattc taataaacgc tcttttctct taggtttacc

       61 cgccaatata tcctgtcaaa cactgatagt ttaaactgaa ggcgggaaac gacaatctga

      121 tccaagctca agctgctcta gcattcgcca ttcaggctgc gcaactgttg ggaagggcga

      181 tcggtgcggg cctcttcgct attacgccag ctggcgaaag ggggatgtgc tgcaaggcga

      241 ttaagttggg taacgccagg gttttcccag tcacgacgtt gtaaaacgac ggccagtgcc

      301 aagcttgcat gcctgcaggt ccccagatta gccttttcaa tttcagaaag aatgctaacc

      361 cacagatggt tagagaggct tacgcagcag gtctcatcaa gacgatctac ccgagcaata

      421 atctccagga aatcaaatac cttcccaaga aggttaaaga tgcagtcaaa agattcagga

      481 ctaactgcat caagaacaca gagaaagata tatttctcaa gatcagaagt actattccag

      541 tatggacgat tcaaggcttg cttcacaaac caaggcaagt aatagagatt ggagtctcta

      601 aaaaggtagt tcccactgaa tcaaaggcca tggagtcaaa gattcaaata gaggacctaa

      661 cagaactcgc cgtaaagact ggcgaacagt tcatacagag tctcttacga ctcaatgaca

      721 agaagaaaat cttcgtcaac atggtggagc acgacacact tgtctactcc aaaaatatca

      781 aagatacagt ctcagaagac caaagggcaa ttgagacttt tcaacaaagg gtaatatccg

      841 gaaacctcct cggattccat tgcccagcta tctgtcactt tattgtgaag atagtggaaa

      901 aggaaggtgg ctcctacaaa tgccatcatt gcgataaagg aaaggccatc gttgaagatg

      961 cctctgccga cagtggtccc aaagatggac ccccacccac gaggagcatc gtggaaaaag

     1021 aagacgttcc aaccacgtct tcaaagcaag tggattgatg tgatatctcc actgacgtaa

     1081 gggatgacgc acaatcccac tatccttcgc aagacccttc ctctatataa ggaagttcat

     1141 ttcatttgga gagaacacgg gggactctag aatgagcatg gcctcctccg aggacgtcat

     1201 caaggagttc atgcgcttca aggtgcgcat ggagggctcc gtgaacggcc acgagttcga

     1261 gatcgagggc gagggcgagg gccgccccta cgagggcacc cagaccgcca agctgaaggt

     1321 gaccaagggc ggccccctgc ccttcgcctg ggacatcctg tcccctcagt tccagtacgg

     1381 ctccaaggcc tacgtgaagc accccgccga catccccgac tacttgaagc tgtccttccc

     1441 cgagggcttc aagtgggagc gcgtgatgaa cttcgaggac ggcggcgtgg tgaccgtgac

     1501 ccaggactcc tccctgcagg acggcgagtt catctacaag gtgaagctgc gcggcaccaa

     1561 cttcccctcc gacggccccg taatgcagaa gaagaccatg ggctgggagg cctccaccga

     1621 gcggatgtac cccgaggacg gcgccctgaa gggcgagatc aagatgaggc tgaagctgaa

     1681 ggacggcggc cactacgacg ccgaggtcaa gaccacctac atggccaaga agcccgtgca

     1741 gctgcccggc gcctacaaga ccgacatcaa gctggacatc acctcccaca acgaggacta

     1801 caccatcgtg gaacagtacg agcgcgccga gggccgccac tccaccggcg ccgctgttat

     1861 cacaagtttg tacaaaaaag ctgaacgaga aacgtaaaat gatataaata tcaatatatt

     1921 aaattagatt ttgcataaaa aacagactac ataatactgt aaaacacaac atatccagtc

     1981 actatggcgg cccctcgagg ggccgcatta ggcaccccag gctttacact ttatgcttcc

     2041 ggctcgtata atgtgtggat tttgagttag gatccggcga gattttcagg agctaaggaa

     2101 gctaaaatgg agaaaaaaat cactggatat accaccgttg atatatccca atggcatcgt

     2161 aaagaacatt ttgaggcatt tcagtcagtt gctcaatgta cctataacca gaccgttcag

     2221 ctggatatta cggccttttt aaagaccgta aagaaaaata agcacaagtt ttatccggcc

     2281 tttattcaca ttcttgcccg cctgatgaat gctcatccgg aattccgtat ggcaatgaaa

     2341 gacggtgagc tggtgatatg ggatagtgtt cacccttgtt acaccgtttt ccatgagcaa

     2401 actgaaacgt tttcatcgct ctggagtgaa taccacgacg atttccggca gtttctacac

     2461 atatattcgc aagatgtggc gtgttacggt gaaaacctgg cctatttccc taaagggttt

     2521 attgagaata tgtttttcgt ctcagccaat ccctgggtga gtttcaccag ttttgattta

     2581 aacgtggcca atatggacaa cttcttcgcc cccgttttca ccatgggcaa atattatacg

     2641 caaggcgaca aggtgctgat gccgctggcg attcaggttc atcatgccgt ctgtgatggc

     2701 ttccatgtcg gcagaatgct taatgaatta caacagtact gcgatgagtg gcagggcggg

     2761 gcgtaaacgc gtggatccgg cttactaaaa gccagataac agtatgcgta tttgcgcgct

     2821 gatttttgcg gtataagaat atatactgat atgtataccc gaagtatgtc aaaaagaggt

     2881 gtgctatgaa gcagcgtatt acagtgacag ttgacagcga cagctatcag ttgctcaagg

     2941 catatatgat gtcaatatct ccggtctggt aagcacaacc atgcagaatg aagcccgtcg

     3001 tctgcgtgcc gaacgctgga aagcggaaaa tcaggaaggg atggctgagg tcgcccggtt

     3061 tattgaaatg aacggctctt ttgctgacga gaacagggac tggtgaaatg cagtttaagg

     3121 tttacaccta taaaagagag agccgttatc gtctgtttgt ggatgtacag agtgatatta

     3181 ttgacacgcc cgggcgacgg atggtgatcc ccctggccag tgcacgtctg ctgtcagata

     3241 aagtctcccg tgaactttac ccggtggtgc atatcgggga tgaaagctgg cgcatgatga

     3301 ccaccgatat ggccagtgtg ccggtctccg ttatcgggga agaagtggct gatctcagcc

     3361 accgcgaaaa tgacatcaaa aacgccatta acctgatgtt ctggggaata taaatgtcag

     3421 gctcccttat acacagccag tctgcaggtc gaccatagtg actggatatg ttgtgtttta

     3481 cagtattatg tagtctgttt tttatgcaaa atctaattta atatattgat atttatatca

     3541 ttttacgttt ctcgttcagc tttcttgtac aaagtggtga taacctagag ctcgaatttc

     3601 cccgatcgtt caaacatttg gcaataaagt ttcttaagat tgaatcctgt tgccggtctt

     3661 gcgatgatta tcatataatt tctgttgaat tacgttaagc atgtaataat taacatgtaa

     3721 tgcatgacgt tatttatgag atgggttttt atgattagag tcccgcaatt atacatttaa

     3781 tacgcgatag aaaacaaaat atagcgcgca aactaggata aattatcgcg cgcggtgtca

     3841 tctatgttac tagatcggga attggttccg gaaccaattc gtaatcatgg tcatagctgt

     3901 ttcctgtgtg aaattgttat ccgctcacaa ttccacacaa catacgagcc ggaagcataa

     3961 agtgtaaagc ctggggtgcc taatgagtga gctaactcac attaggctga attaggcgcg

     4021 cctatttctg aattcccgat ctagtaacat agatgacacc gcgcgcgata atttatccta

     4081 gtttgcgcgc tatattttgt tttctatcgc gtattaaatg tataattgcg ggactctaat

     4141 cataaaaacc catctcataa ataacgtcat gcattacatg ttaattatta catgcttaac

     4201 gtaattcaac agaaattata tgataatcat cgcaagaccg gcaacaggat tcaatcttaa

     4261 gaaactttat tgccaaatgt ttgaacgatc ggggatcatc cgggtctgtg gcgggaactc

     4321 cacgaaaata tccgaacgca gcaagatatc gcggtgcatc tcggtcttgc ctgggcagtc

     4381 gccgccgacg ccgttgatgt ggacgccggg cccgatcata ttgtcgctca ggatcgtggc

     4441 gttgtgcttg tcggccgttg ctgtcgtaat gatatcggca ccttcgaccg cctgttccgc

     4501 agagatcccg tgggcgaaga actccagcat gagatccccg cgctggagga tcatccagcc

     4561 ggcgtcccgg aaaacgattc cgaagcccaa cctttcatag aaggcggcgg tggaatcgaa

     4621 atctcgtgat ggcaggttgg gcgtcgcttg gtcggtcatt tcgaacccca gagtcccgct

     4681 cagaagaact cgtcaagaag gcgatagaag gcgatgcgct gcgaatcggg agcggcgata

     4741 ccgtaaagca cgaggaagcg gtcagcccat tcgccgccaa gctcttcagc aatatcacgg

     4801 gtagccaacg ctatgtcctg atagcggtcc gccacaccca gccggccaca gtcgatgaat

     4861 ccagaaaagc ggccattttc caccatgata ttcggcaagc aggcatcgcc atgggtcacg

     4921 acgagatcat cgccgtcggg catgcgcgcc ttgagcctgg cgaacagttc ggctggcgcg

     4981 agcccctgat gctcttcgtc cagatcatcc tgatcgacaa gaccggcttc catccgagta

     5041 cgtgctcgct cgatgcgatg tttcgcttgg tggtcgaatg ggcaggtagc cggatcaagc

     5101 gtatgcagcc gccgcattgc atcagccatg atggatactt tctcggcagg agcaaggtga

     5161 gatgacagga gatcctgccc cggcacttcg cccaatagca gccagtccct tcccgcttca

     5221 gtgacaacgt cgagcacagc tgcgcaagga acgcccgtcg tggccagcca cgatagccgc

     5281 gctgcctcgt cctgcagttc attcagggca ccggacaggt cggtcttgac aaaaagaacc

     5341 gggcgcccct gcgctgacag ccggaacacg gcggcatcag agcagccgat tgtctgttgt

     5401 gcccagtcat agccgaatag cctctccacc caagcggccg gagaacctgc gtgcaatcca

     5461 tcttgttcaa tcatgcgaaa cgatccagat ccggtgcaga ttatttggat tgagagtgaa

     5521 tatgagactc taattggata ccgaggggaa tttatggaac gtcagtggag catttttgac

     5581 aagaaatatt tgctagctga tagtgacctt aggcgacttt tgaacgcgca ataatggttt

     5641 ctgacgtatg tgcttagctc attaaactcc agaaacccgc ggctgagtgg ctccttcaac

     5701 gttgcggttc tgtcagttcc aaacgtaaaa cggcttgtcc cgcgtcatcg gcgggggtca

     5761 taacgtgact cccttaattc tccgctcatg atgaattcag aaataaattc agcctaattc

     5821 ggcgttaatt cagtacatta aaaacgtccg caatgtgtta ttaagttgtc taagcgtcaa

     5881 tttgtttaca ccacaatata tcctgccacc agccagccaa cagctccccg accggcagct

     5941 cggcacaaaa tcaccactcg atacaggcag cccatcagtc cgggacggcg tcagcgggag

     6001 agccgttgta aggcggcaga ctttgctcat gttaccgatg ctattcggaa gaacggcaac

     6061 taagctgccg ggtttgaaac acggatgatc tcgcggaggg tagcatgttg attgtaacga

     6121 tgacagagcg ttgctgcctg tgatcaattc gggcacgaac ccagtggaca taagcctgtt

     6181 cggttcgtaa gctgtaatgc aagtagcgta tgcgctcacg caactggtcc agaaccttga

     6241 ccgaacgcag cggtggtaac ggcgcagtgg cggttttcat ggcttgttat gactgttttt

     6301 ttggggtaca gtctatgcct cgggcatcca agcagcaagc gcgttacgcc gtgggtcgat

     6361 gtttgatgtt atggagcagc aacgatgtta cgcagcaggg cagtcgccct aaaacaaagt

     6421 taaacatcat gggggaagcg gtgatcgccg aagtatcgac tcaactatca gaggtagttg

     6481 gcgtcatcga gcgccatctc gaaccgacgt tgctggccgt acatttgtac ggctccgcag

     6541 tggatggcgg cctgaagcca cacagtgata ttgatttgct ggttacggtg accgtaaggc

     6601 ttgatgaaac aacgcggcga gctttgatca acgacctttt ggaaacttcg gcttcccctg

     6661 gagagagcga gattctccgc gctgtagaag tcaccattgt tgtgcacgac gacatcattc

     6721 cgtggcgtta tccagctaag cgcgaactgc aatttggaga atggcagcgc aatgacattc

     6781 ttgcaggtat cttcgagcca gccacgatcg acattgatct ggctatcttg ctgacaaaag

     6841 caagagaaca tagcgttgcc ttggtaggtc cagcggcgga ggaactcttt gatccggttc

     6901 ctgaacagga tctatttgag gcgctaaatg aaaccttaac gctatggaac tcgccgcccg

     6961 actgggctgg cgatgagcga aatgtagtgc ttacgttgtc ccgcatttgg tacagcgcag

     7021 taaccggcaa aatcgcgccg aaggatgtcg ctgccgactg ggcaatggag cgcctgccgg

     7081 cccagtatca gcccgtcata cttgaagcta gacaggctta tcttggacaa gaagaagatc

     7141 gcttggcctc gcgcgcagat cagttggaag aatttgtcca ctacgtgaaa ggcgagatca

     7201 ccaaggtagt cggcaaataa tgtctagcta gaaattcgtt caagccgacg ccgcttcgcg

     7261 gcgcggctta actcaagcgt tagatgcact aagcacataa ttgctcacag ccaaactatc

     7321 aggtcaagtc tgcttttatt atttttaagc gtgcataata agccctacac aaattgggag

     7381 atatatcatg catgaccaaa atcccttaac gtgagttttc gttccactga gcgtcagacc

     7441 ccgtagaaaa gatcaaagga tcttcttgag atcctttttt tctgcgcgta atctgctgct

     7501 tgcaaacaaa aaaaccaccg ctaccagcgg tggtttgttt gccggatcaa gagctaccaa

     7561 ctctttttcc gaaggtaact ggcttcagca gagcgcagat accaaatact gtccttctag

     7621 tgtagccgta gttaggccac cacttcaaga actctgtagc accgcctaca tacctcgctc

     7681 tgctaatcct gttaccagtg gctgctgcca gtggcgataa gtcgtgtctt accgggttgg

     7741 actcaagacg atagttaccg gataaggcgc agcggtcggg ctgaacgggg ggttcgtgca

     7801 cacagcccag cttggagcga acgacctaca ccgaactgag atacctacag cgtgagctat

     7861 gagaaagcgc cacgcttccc gaagggagaa aggcggacag gtatccggta agcggcaggg

     7921 tcggaacagg agagcgcacg agggagcttc cagggggaaa cgcctggtat ctttatagtc

     7981 ctgtcgggtt tcgccacctc tgacttgagc gtcgattttt gtgatgctcg tcaggggggc

     8041 ggagcctatg gaaaaacgcc agcaacgcgg cctttttacg gttcctggcc ttttgctggc

     8101 cttttgctca catgttcttt cctgcgttat cccctgattc tgtggataac cgtattaccg

     8161 cctttgagtg agctgatacc gctcgccgca gccgaacgac cgagcgcagc gagtcagtga

     8221 gcgaggaagc ggaagagcgc ctgatgcggt attttctcct tacgcatctg tgcggtattt

     8281 cacaccgcat atggtgcact ctcagtacaa tctgctctga tgccgcatag ttaagccagt

     8341 atacactccg ctatcgctac gtgactgggt catggctgcg ccccgacacc cgccaacacc

     8401 cgctgacgcg ccctgacggg cttgtctgct cccggcatcc gcttacagac aagctgtgac

     8461 cgtctccggg agctgcatgt gtcagaggtt ttcaccgtca tcaccgaaac gcgcgaggca

     8521 gggtgccttg atgtgggcgc cggcggtcga gtggcgacgg cgcggcttgt ccgcgccctg

     8581 gtagattgcc tggccgtagg ccagccattt ttgagcggcc agcggccgcg ataggccgac

     8641 gcgaagcggc ggggcgtagg gagcgcagcg accgaagggt aggcgctttt tgcagctctt

     8701 cggctgtgcg ctggccagac agttatgcac aggccaggcg ggttttaaga gttttaataa

     8761 gttttaaaga gttttaggcg gaaaaatcgc cttttttctc ttttatatca gtcacttaca

     8821 tgtgtgaccg gttcccaatg tacggctttg ggttcccaat gtacgggttc cggttcccaa

     8881 tgtacggctt tgggttccca atgtacgtgc tatccacagg aaagagacct tttcgacctt

     8941 tttcccctgc tagggcaatt tgccctagca tctgctccgt acattaggaa ccggcggatg

     9001 cttcgccctc gatcaggttg cggtagcgca tgactaggat cgggccagcc tgccccgcct

     9061 cctccttcaa atcgtactcc ggcaggtcat ttgacccgat cagcttgcgc acggtgaaac

     9121 agaacttctt gaactctccg gcgctgccac tgcgttcgta gatcgtcttg aacaaccatc

     9181 tggcttctgc cttgcctgcg gcgcggcgtg ccaggcggta gagaaaacgg ccgatgccgg

     9241 gatcgatcaa aaagtaatcg gggtgaaccg tcagcacgtc cgggttcttg ccttctgtga

     9301 tctcgcggta catccaatca gctagctcga tctcgatgta ctccggccgc ccggtttcgc

     9361 tctttacgat cttgtagcgg ctaatcaagg cttcaccctc ggataccgtc accaggcggc

     9421 cgttcttggc cttcttcgta cgctgcatgg caacgtgcgt ggtgtttaac cgaatgcagg

     9481 tttctaccag gtcgtctttc tgctttccgc catcggctcg ccggcagaac ttgagtacgt

     9541 ccgcaacgtg tggacggaac acgcggccgg gcttgtctcc cttcccttcc cggtatcggt

     9601 tcatggattc ggttagatgg gaaaccgcca tcagtaccag gtcgtaatcc cacacactgg

     9661 ccatgccggc cggccctgcg gaaacctcta cgtgcccgtc tggaagctcg tagcggatca

     9721 cctcgccagc tcgtcggtca cgcttcgaca gacggaaaac ggccacgtcc atgatgctgc

     9781 gactatcgcg ggtgcccacg tcatagagca tcggaacgaa aaaatctggt tgctcgtcgc

     9841 ccttgggcgg cttcctaatc gacggcgcac cggctgccgg cggttgccgg gattctttgc

     9901 ggattcgatc agcggccgct tgccacgatt caccggggcg tgcttctgcc tcgatgcgtt

     9961 gccgctgggc ggcctgcgcg gccttcaact tctccaccag gtcatcaccc agcgccgcgc

    10021 cgatttgtac cgggccggat ggtttgcgac cgctcacgcc gattcctcgg gcttgggggt

    10081 tccagtgcca ttgcagggcc ggcagacaac ccagccgctt acgcctggcc aaccgcccgt

    10141 tcctccacac atggggcatt ccacggcgtc ggtgcctggt tgttcttgat tttccatgcc

    10201 gcctccttta gccgctaaaa ttcatctact catttattca tttgctcatt tactctggta

    10261 gctgcgcgat gtattcagat agcagctcgg taatggtctt gccttggcgt accgcgtaca

    10321 tcttcagctt ggtgtgatcc tccgccggca actgaaagtt gacccgcttc atggctggcg

    10381 tgtctgccag gctggccaac gttgcagcct tgctgctgcg tgcgctcgga cggccggcac

    10441 ttagcgtgtt tgtgcttttg ctcattttct ctttacctca ttaactcaaa tgagttttga

    10501 tttaatttca gcggccagcg cctggacctc gcgggcagcg tcgccctcgg gttctgattc

    10561 aagaacggtt gtgccggcgg cggcagtgcc tgggtagctc acgcgctgcg tgatacggga

    10621 ctcaagaatg ggcagctcgt acccggccag cgcctcggca acctcaccgc cgatgcgcgt

    10681 gcctttgatc gcccgcgaca cgacaaaggc cgcttgtagc cttccatccg tgacctcaat

    10741 gcgctgctta accagctcca ccaggtcggc ggtggcccat atgtcgtaag ggcttggctg

    10801 caccggaatc agcacgaagt cggctgcctt gatcgcggac acagccaagt ccgccgcctg

    10861 gggcgctccg tcgatcacta cgaagtcgcg ccggccgatg gccttcacgt cgcggtcaat

    10921 cgtcgggcgg tcgatgccga caacggttag cggttgatct tcccgcacgg ccgcccaatc

    10981 gcgggcactg ccctggggat cggaatcgac taacagaaca tcggccccgg cgagttgcag

    11041 ggcgcgggct agatgggttg cgatggtcgt cttgcctgac ccgcctttct ggttaagtac

    11101 agcgataacc ttcatgcgtt ccccttgcgt atttgtttat ttactcatcg catcatatac

    11161 gcagcgaccg catgacgcaa gctgttttac tcaaatacac atcacctttt tagacggcgg

    11221 cgctcggttt cttcagcggc caagctggcc ggccaggccg ccagcttggc atcagacaaa

    11281 ccggccagga tttcatgcag ccgcacggtt gagacgtgcg cgggcggctc gaacacgtac

    11341 ccggccgcga tcatctccgc ctcgatctct tcggtaatga aaaacggttc gtcctggccg

    11401 tcctggtgcg gtttcatgct tgttcctctt ggcgttcatt ctcggcggcc gccagggcgt

    11461 cggcctcggt caatgcgtcc tcacggaagg caccgcgccg cctggcctcg gtgggcgtca

    11521 cttcctcgct gcgctcaagt gcgcggtaca gggtcgagcg atgcacgcca agcagtgcag

    11581 ccgcctcttt cacggtgcgg ccttcctggt cgatcagctc gcgggcgtgc gcgatctgtg

    11641 ccggggtgag ggtagggcgg gggccaaact tcacgcctcg ggccttggcg gcctcgcgcc

    11701 cgctccgggt gcggtcgatg attagggaac gctcgaactc ggcaatgccg gcgaacacgg

    11761 tcaacaccat gcggccggcc ggcgtggtgg tgtcggccca cggctctgcc aggctacgca

    11821 ggcccgcgcc ggcctcctgg atgcgctcgg caatgtccag taggtcgcgg gtgctgcggg

    11881 ccaggcggtc tagcctggtc actgtcacaa cgtcgccagg gcgtaggtgg tcaagcatcc

    11941 tggccagctc cgggcggtcg cgcctggtgc cggtgatctt ctcggaaaac agcttggtgc

    12001 agccggccgc gtgcagttcg gcccgttggt tggtcaagtc ctggtcgtcg gtgctgacgc

    12061 gggcatagcc cagcaggcca gcggcggcgc tcttgttcat ggcgtaatgt ctccggttct

    12121 agtcgcaagt attctacttt atgcgactaa aacacgcgac aagaaaacgc caggaaaagg

    12181 gcagggcggc agcctgtcgc gtaacttagg acttgtgcga catgtcgttt tcagaagacg

    12241 gctgcactga acgtcagaag ccgactgcac tatagcagcg gaggggttgg atcaaagtac

    12301 tttgatcccg aggggaaccc tgtggttggc atgcacatac aaatggacga acggataaac

    12361 ct

//


Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart