pHBT- GFP- NOS

$260.00

  • Model: PVT11195
  • 50 Units in Stock
Ask a question


Add to Cart:

pHBT-GFP-NOS


Catalog No. PVT11195
Packing 2ug

 

pHBT-GFP-NOS Informaiton

Promoter: 35S

Replicon: pUC

Prokaryotic resistance: Amp

Eukaryotic resistance: green fluorescent protein EGFP

Clone strain: DH5a

Culture conditions: 37℃

Plasmid host: plant

Plasmid usage: signal report

Fragment type:-

Fragment species:-

Prokaryotic resistance: Amp

Eukaryotic resistance:-

Fluorescent label: Green

 

pHBT-GFP-NOS Description

pHBT-GFP-NOS is a green fluorescent expression plasmid in plant cells, which size is 4281bp and resistance is Amp.

pHBT-GFP-NOS-plasmid

 

pHBT-GFP-NOS Sequence

LOCUS       Exported                4281 bp ds-DNA     circular SYN 24-MAY-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..4281

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     primer_bind     complement(39..55)

                     /label=M13 rev

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     protein_bind    63..79

                     /label=lac operator

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        complement(87..117)

                     /label=lac promoter

                     /note="promoter for the E. coli lac operon"

     protein_bind    132..153

                     /label=CAP binding site

                     /bound_moiety="E. coli catabolite activator protein"

                     /note="CAP binding activates transcription in the presence 

                     of cAMP."

     rep_origin      complement(441..1029)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1200..2060)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2061..2165)

                     /gene="bla"

                     /label=AmpR promoter

     primer_bind     2639..2655

                     /label=M13 fwd

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     promoter        2722..3231

                     /label=35SPPDK promoter

                     /note="hybrid promoter consisting of the cauliflower mosaic

                     virus 35S enhancer fused to the maize C4PPDK basal promoter

                     (Yoo et al., 2007)"

     misc_feature    3238..3290

                     /label=MCS

                     /note="multiple cloning site"

     misc_feature    3264..3294

                     /label=MCS

     CDS             3291..4010

                     /codon_start=1

                     /product="enhanced GFP"

                     /label=EGFP

                     /note="mammalian codon-optimized"

                     /translation="MVSKGEELFTGVVPILVELDGDVNGHKFSVSGEGEGDATYGKLTL

                     KFICTTGKLPVPWPTLVTTFTYGVQCFSRYPDHMKQHDFFKSAMPEGYVQERTIFFKDD

                     GNYKTRAEVKFEGDTLVNRIELKGIDFKEDGNILGHKLEYNYNSHNVYIMADKQKNGIK

                     VNFKIRHNIEDGSVQLADHYQQNTPIGDGPVLLPDNHYLSTQSALSKDPNEKRDHMVLL

                     EFVTAAGITHGMDELYK"

     terminator      4029..4281

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

ORIGIN

        1 cgatgataag ctgtcaaaca tgagaattcg taatcatggt catagctgtt tcctgtgtga

       61 aattgttatc cgctcacaat tccacacaac atacgagccg gaagcataaa gtgtaaagcc

      121 tggggtgcct aatgagtgag ctaactcaca ttaattgcgt tgcgctcact gcccgctttc

      181 cagtcgggaa acctgtcgtg ccagctgcat taatgaatcg gccaacgcgc ggggagaggc

      241 ggtttgcgta ttgggcgctc ttccgcttcc tcgctcactg actcgctgcg ctcggtcgtt

      301 cggctgcggc gagcggtatc agctcactca aaggcggtaa tacggttatc cacagaatca

      361 ggggataacg caggaaagaa catgtgagca aaaggccagc aaaaggccag gaaccgtaaa

      421 aaggccgcgt tgctggcgtt tttccatagg ctccgccccc ctgacgagca tcacaaaaat

      481 cgacgctcaa gtcagaggtg gcgaaacccg acaggactat aaagatacca ggcgtttccc

      541 cctggaagct ccctcgtgcg ctctcctgtt ccgaccctgc cgcttaccgg atacctgtcc

      601 gcctttctcc cttcgggaag cgtggcgctt tctcatagct cacgctgtag gtatctcagt

      661 tcggtgtagg tcgttcgctc caagctgggc tgtgtgcacg aaccccccgt tcagcccgac

      721 cgctgcgcct tatccggtaa ctatcgtctt gagtccaacc cggtaagaca cgacttatcg

      781 ccactggcag cagccactgg taacaggatt agcagagcga ggtatgtagg cggtgctaca

      841 gagttcttga agtggtggcc taactacggc tacactagaa ggacagtatt tggtatctgc

      901 gctctgctga agccagttac cttcggaaaa agagttggta gctcttgatc cggcaaacaa

      961 accaccgctg gtagcggtgg tttttttgtt tgcaagcagc agattacgcg cagaaaaaaa

     1021 ggatctcaag aagatccttt gatcttttct acggggtctg acgctcagtg gaacgaaaac

     1081 tcacgttaag ggattttggt catgagatta tcaaaaagga tcttcaccta gatcctttta

     1141 aattaaaaat gaagttttaa atcaatctaa agtatatatg agtaaacttg gtctgacagt

     1201 taccaatgct taatcagtga ggcacctatc tcagcgatct gtctatttcg ttcatccata

     1261 gttgcctgac tccccgtcgt gtagataact acgatacggg agggcttacc atctggcccc

     1321 agtgctgcaa tgataccgcg agacccacgc tcaccggctc cagatttatc agcaataaac

     1381 cagccagccg gaagggccga gcgcagaagt ggtcctgcaa ctttatccgc ctccatccag

     1441 tctattaatt gttgccggga agctagagta agtagttcgc cagttaatag tttgcgcaac

     1501 gttgttgcca ttgctacagg catcgtggtg tcacgctcgt cgtttggtat ggcttcattc

     1561 agctccggtt cccaacgatc aaggcgagtt acatgatccc ccatgttgtg caaaaaagcg

     1621 gttagctcct tcggtcctcc gatcgttgtc agaagtaagt tggccgcagt gttatcactc

     1681 atggttatgg cagcactgca taattctctt actgtcatgc catccgtaag atgcttttct

     1741 gtgactggtg agtactcaac caagtcattc tgagaatagt gtatgcggcg accgagttgc

     1801 tcttgcccgg cgtcaatacg ggataatacc gcgccacata gcagaacttt aaaagtgctc

     1861 atcattggaa aacgttcttc ggggcgaaaa ctctcaagga tcttaccgct gttgagatcc

     1921 agttcgatgt aacccactcg tgcacccaac tgatcttcag catcttttac tttcaccagc

     1981 gtttctgggt gagcaaaaac aggaaggcaa aatgccgcaa aaaagggaat aagggcgaca

     2041 cggaaatgtt gaatactcat actcttcctt tttcaatatt attgaagcat ttatcagggt

     2101 tattgtctca tgagcggata catatttgaa tgtatttaga aaaataaaca aataggggtt

     2161 ccgcgcacat ttccccgaaa agtgccacct gacgtctaag aaaccattat tatcatgaca

     2221 ttaacctata aaaataggcg tatcacgagg ccctttcgtc tcgcgcgttt cggtgatgac

     2281 ggtgaaaacc tctgacacat gcagctcccg gagacggtca cagcttgtct gtaagcggat

     2341 gccgggagca gacaagcccg tcagggcgcg tcagcgggtg ttggcgggtg tcggggctgg

     2401 cttaactatg cggcatcaga gcagattgta ctgagagtgc accatatgcg gtgtgaaata

     2461 ccgcacagat gcgtaaggag aaaataccgc atcaggcgcc attcgccatt caggctgcgc

     2521 aactgttggg aagggcgatc ggtgcgggcc tcttcgctat tacgccagct ggcgaaaggg

     2581 ggatgtgctg caaggcgatt aagttgggta acgccagggt tttcccagtc acgacgttgt

     2641 aaaacgacgg ccagtgccaa gctctcgaga agcttactcc aagaatatca aagatacagt

     2701 ctcagaagac caaagggcta ttgagacttt tcaacaaagg gtaatatcgg gaaacctcct

     2761 cggattccat tgcccagcta tctgtcactt catcaaaagg acagtagaaa aggaaggtgg

     2821 cacctacaaa tgccatcatt gcgataaagg aaaggctatc gttcaagatg cctctgccga

     2881 cagtggtccc aaagatggac ccccacccac aaggagcatc gtggaaaaag aagacgttcc

     2941 aaccacgtct tcaaagcaag tggattgatg tgatatctcc actgacgtaa gggatgacgc

     3001 acaatcccac tatccttcgc cccaagcttg ggcccaagct tgggtcgcgc cccacggatg

     3061 gtataagaat aaaggcattc cgcgtgcagg attcacccgt tcgcctctca ccttttcgct

     3121 gtactctctc gccacacaca ccccctctcc agctccgttg gagctccgga cagcagcagg

     3181 cgcggggcgg tcacgtagta agcagctctc ggctccctct ccccttgctc cgtggatctc

     3241 gagctcaagc ttcgaattct gcagtcgacg gtaccgcggg cccgggatcc atggtgagca

     3301 agggcgagga gctgttcacc ggggtggtgc ccatcctggt cgagctggac ggcgacgtaa

     3361 acggccacaa gttcagcgtg tccggcgagg gcgagggcga tgccacctac ggcaagctga

     3421 ccctgaagtt catctgcacc accggcaagc tgcccgtgcc ctggcccacc ctcgtgacca

     3481 ccttcaccta cggcgtgcag tgcttcagcc gctaccccga ccacatgaag cagcacgact

     3541 tcttcaagtc cgccatgccc gaaggctacg tccaggagcg caccatcttc ttcaaggacg

     3601 acggcaacta caagacccgc gccgaggtga agttcgaggg cgacaccctg gtgaaccgca

     3661 tcgagctgaa gggcatcgac ttcaaggagg acggcaacat cctggggcac aagctggagt

     3721 acaactacaa cagccacaac gtctatatca tggccgacaa gcagaagaac ggcatcaagg

     3781 tgaacttcaa gatccgccac aacatcgagg acggcagcgt gcagctcgcc gaccactacc

     3841 agcagaacac ccccatcggc gacggccccg tgctgctgcc cgacaaccac tacctgagca

     3901 cccagtccgc cctgagcaaa gaccccaacg agaagcgcga tcacatggtc ctgctggagt

     3961 tcgtgaccgc cgccgggatc actcacggca tggacgagct gtacaagtaa agcggccgcc

     4021 cggctgcaga tcgttcaaac atttggcaat aaagtttctt aagattgaat cctgttgccg

     4081 gtcttgcgat gattatcata tatatttctg ttgattacgt taagcatgta ataattaaca

     4141 tgtaatgcat gacgttattt atgagatggg tttttatgat tagagtcccg caattataca

     4201 tttaatacgc gatagaaaac aaaatatagc gcgcaaacta ggataaatta tcgcgcgcgg

     4261 tgtcatctat gttactagat c

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart