pHCMC04

$260.00

  • Model: PVT11309
  • 49 Units in Stock
Ask a question


Add to Cart:

pHCMC04

Catalog No. PVT11309
Packing 2ug

 

pHCMC04 Information

Promoter: xylA promoter

Prokaryotic resistance: ampicillin Amp

Screening markers: chloramphenicol Chl

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 degrees centigrade

Expression host: Bacillus subtilis

Inducement: xylose

 

pHCMC04 Description

PHCMC04 is a Bacillus subtilis xylose inducible expression plasmid.

pHCMC04-vector

 

pHCMC04 Sequence

LOCUS       Exported                8089 bp ds-DNA     circular SYN 06-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..8089

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     rep_origin      complement(440..1028)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number colE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(1199..2059)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2060..2164)

                     /gene="bla"

                     /label=AmpR promoter

     CDS             complement(2343..2993)

                     /codon_start=1

                     /label=Chl

                     /translation="MNFNKIDLDNWKRKEIFNHYLNQQTTFSITTEIDISVLYRNIKQE

                     GYKFYPAFIFLVTRVINSNTAFRTGYNSDGELGYWDKLEPLYTIFDGVSKTFSGIWTPV

                     KNDFKEFYDLYLSDVEKYNGSGKLFPKTPIPENAFSLSIIPWTSFTGFNLNINNNSNYL

                     LPIITAGKFINKGNSIYLPLSLQVHHSVCDGYHAGLFMNSIQELSDRPNDWLL"

     CDS             complement(3497..4621)

                     /codon_start=1

                     /label=xylR

                     /translation="MNQKLILDEILKNSPVSRATLSEITGLNKSTVSSQVNTLLEKDFI

                     FEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEGNIILEKTSDLSSSS

                     ASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIFMPNLNWNIKDLQFL

                     IESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGTGLVINNELYKGVQG

                     FSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNISRKEIVERANKNDV

                     EMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNTIKNEVSSRVHSHLD

                     NKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS"

     misc_feature    4729..4882

                     /label=xylA promoter

     misc_feature    4805..4829

                     /label=xylO

     misc_feature    4898..4997

                     /label=MCS

ORIGIN

        1 tcgaggcctg caggcatgca agcttggcgt aatcatggtc atagctgttt cctgtgtgaa

       61 attgttatcc gctcacaatt ccacacaaca tacgagccgg aagcataaag tgtaaagcct

      121 ggggtgccta atgagtgagc taactcacat taattgcgtt gcgctcactg cccgctttcc

      181 agtcgggaaa cctgtcgtgc cagctgcatt aatgaatcgg ccaacgcgcg gggagaggcg

      241 gtttgcgtat tgggcgctct tccgcttcct cgctcactga ctcgctgcgc tcggtcgttc

      301 ggctgcggcg agcggtatca gctcactcaa aggcggtaat acggttatcc acagaatcag

      361 gggataacgc aggaaagaac atgtgagcaa aaggccagca aaaggccagg aaccgtaaaa

      421 aggccgcgtt gctggcgttt ttccataggc tccgcccccc tgacgagcat cacaaaaatc

      481 gacgctcaag tcagaggtgg cgaaacccga caggactata aagataccag gcgtttcccc

      541 ctggaagctc cctcgtgcgc tctcctgttc cgaccctgcc gcttaccgga tacctgtccg

      601 cctttctccc ttcgggaagc gtggcgcttt ctcatagctc acgctgtagg tatctcagtt

      661 cggtgtaggt cgttcgctcc aagctgggct gtgtgcacga accccccgtt cagcccgacc

      721 gctgcgcctt atccggtaac tatcgtcttg agtccaaccc ggtaagacac gacttatcgc

      781 cactggcagc agccactggt aacaggatta gcagagcgag gtatgtaggc ggtgctacag

      841 agttcttgaa gtggtggcct aactacggct acactagaag gacagtattt ggtatctgcg

      901 ctctgctgaa gccagttacc ttcggaaaaa gagttggtag ctcttgatcc ggcaaacaaa

      961 ccaccgctgg tagcggtggt ttttttgttt gcaagcagca gattacgcgc agaaaaaaag

     1021 gatctcaaga agatcctttg atcttttcta cggggtctga cgctcagtgg aacgaaaact

     1081 cacgttaagg gattttggtc atgagattat caaaaaggat cttcacctag atccttttaa

     1141 attaaaaatg aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt

     1201 accaatgctt aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag

     1261 ttgcctgact ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca

     1321 gtgctgcaat gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc

     1381 agccagccgg aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt

     1441 ctattaattg ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg

     1501 ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca

     1561 gctccggttc ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg

     1621 ttagctcctt cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca

     1681 tggttatggc agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg

     1741 tgactggtga gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct

     1801 cttgcccggc gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca

     1861 tcattggaaa acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca

     1921 gttcgatgta acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg

     1981 tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac

     2041 ggaaatgttg aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt

     2101 attgtctcat gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc

     2161 cgcgcacatt tccccgaaaa gtgccacctg actgccgggc ctcttgcggg atcggcgagg

     2221 ctagttaccc ttaagttatt ggtatgactg gttttaagcg caaaaaaagt tgctttttcg

     2281 tacctattaa tgtatcgttt tagaaaaccg actgtaaaaa gtacagtcgg cattatctca

     2341 tattataaaa gccagtcatt aggcctatct gacaattcct gaatagagtt cataaacaat

     2401 cctgcatgat aaccatcaca aacagaatga tgtacctgta aagatagcgg taaatatatt

     2461 gaattacctt tattaatgaa ttttcctgct gtaataatgg gtagaaggta attactatta

     2521 ttattgatat ttaagttaaa cccagtaaat gaagtccatg gaataataga aagagaaaaa

     2581 gcattttcag gtataggtgt tttgggaaac aatttccccg aaccattata tttctctaca

     2641 tcagaaaggt ataaatcata aaactctttg aagtcattct ttacaggagt ccaaatacca

     2701 gagaatgttt tagatacacc atcaaaaatt gtataaagtg gctctaactt atcccaataa

     2761 cctaactctc cgtcgctatt gtaaccagtt ctaaaagctg tatttgagtt tatcaccctt

     2821 gtcactaaga aaataaatgc agggtaaaat ttatatcctt cttgttttat gtttcggtat

     2881 aaaacactaa tatcaatttc tgtggttata ctaaaagtcg tttgttggtt caaataatga

     2941 ttaaatatct cttttctctt ccaattgtct aaatcaattt tattaaagtt catttgatat

     3001 gcctcctaaa tttttatcta aagtgaattt aggaggctta cttgtctgct ttcttcatta

     3061 gaatcaatcc ttttttaaaa gtcaatatta ctgtaacata aatatatatt ttaaaaatat

     3121 cccactttat ccaattttcg tttgttgaac taatgggtgc tttagttgaa gaataaagac

     3181 cacattaaaa aatgtggtct tttgtgtttt tttaaaggat ttgagcgtag cgaaaaatcc

     3241 ttttctttct tatcttgata ataagggtaa ctattgccga tcgtccattc cgacagcatc

     3301 gccagtcact atggcgtgct gctagcgcca ttcgccattc aggctgcgca actgttggga

     3361 agggcgatcg gtgcgggcct cttcgctatt acgccagctg gcgaaagggg gatgtgctgc

     3421 aaggcgatta agttgggtaa cgccagggtt ttcccagtca cgacgttgta aaacgacggc

     3481 cagtgaattc gagctcctaa cttatagggg taacacttaa aaaagaatca ataacgatag

     3541 aaaccgctcc taaagcaggt gcattttttc ctaacgaaga aggcaatagt tcacatttat

     3601 tgtctaaatg agaatggact ctagaagaaa cttcgttttt aatcgtattt aaaacaatgg

     3661 gatgagattc aattatatga tttctcaaga taacagcttc tatatcaaat gtattaagga

     3721 tattggttaa tccaattccg atataaaagc caaagttttg aagtgcattt aacatttcta

     3781 catcattttt atttgcgcgt tccacaatct cttttcgaga aatattcttt tcttctttag

     3841 agagcgaagc cagtaacgct ttttcagaag catataattc ccaacagcct cgatttccac

     3901 agctgcattt gggtccatta aaatctatcg tcatatgacc catttcccca gaaaaaccct

     3961 gaacaccttt atacaattcg ttgttaataa caagtccagt tccaattccg atattaatac

     4021 tgatgtaaac gatgttttca tagttttttg tcataccaaa tactttttca ccgtatgctc

     4081 ctgcattagc ttcattttca acaaaaaccg gaacattaaa ctcactctca attaaaaact

     4141 gcaaatcttt gatattccaa tttaagttag gcatgaaaat aatttgctga tgacgatcta

     4201 caaggcctgg aacacaaatt cctattccga ctagaccata aggggactca ggcatatggg

     4261 ttacaaaacc atgaataagt gcaaataaaa tctcttttac ttcactagcg gaagaactag

     4321 acaagtcaga agtcttctcg agaataatat ttccttctaa gtcggttaga attccgttaa

     4381 gatagtcgac tcctatatca ataccaatcg agtagcctgc attcttatta aaaacaagca

     4441 ttacaggtct tctgccgcct ctagattgcc ctgccccaat ttcaaaaata aaatcttttt

     4501 caagcagtgt atttacttga gaggagacag tagacttgtt taatcctgta atctcagaga

     4561 gagttgccct ggagacaggg gagttcttca aaatttcatc taatattaat ttttgattca

     4621 ttttttttac taaagcttga tctgcaattt gaataataac cactcctttg tttatccacc

     4681 gaactaagtt ggtgtttttt gaagcttgaa ttagatattt aaaagtatca tatctaatat

     4741 tataactaaa ttttctaaaa aaaacattga aataaacatt tattttgtat atgatgagat

     4801 aaagttagtt tattggataa acaaactaac tcaattaaga tagttgatgg ataaacttgt

     4861 tcacttaaat caaaggggga aatgacaaat ggtccaaact agtgatatct aaaaatcaaa

     4921 gggggaaatg ggatcctcta gagtcgacgt ccccggggca gcccgcctaa tgagcgggct

     4981 tttttcacgt cacgcgtcca tggagatctt tgtctgcaac tgaaaagttt ataccttacc

     5041 tggaacaaat ggttgaaaca tacgaggcta atatcggctt attaggaata gtccctgtac

     5101 taataaaatc aggtggatca gttgatcagt atattttgga cgaagctcgg aaagaatttg

     5161 gagatgactt gcttaattcc acaattaaat taagggaaag aataaagcga tttgatgttc

     5221 aaggaatcac ggaagaagat actcatgata aagaagctct aaaactattc aataacctta

     5281 caatggaatt gatcgaaagg gtggaaggtt aatggtacga aaattagggg atctacctag

     5341 aaagccacaa ggcgataggt caagcttaaa gaacccttac atggatctta cagattctga

     5401 aagtaaagaa acaacagagg ttaaacaaac agaaccaaaa agaaaaaaag cattgttgaa

     5461 aacaatgaaa gttgatgttt caatccataa taagattaaa tcgctgcacg aaattctggc

     5521 agcatccgaa gggaattcat attacttaga ggatactatt gagagagcta ttgataagat

     5581 ggttgagaca ttacctgaga gccaaaaaac tttttatgaa tatgaattaa aaaaaagaac

     5641 caacaaaggc tgagacagac tccaaacgag tctgtttttt taaaaaaaat attaggagca

     5701 ttgaatatat attagagaat taagaaagac atgggaataa aaatatttta aatccagtaa

     5761 aaatatgata agattatttc agaatatgaa gaactctgtt tgtttttgat gaaaaaacaa

     5821 acaaaaaaaa tccacctaac ggaatctcaa tttaactaac agcggccaaa ctgagaagtt

     5881 aaatttgaga aggggaaaag gcggatttat acttgtattt aactatctcc attttaacat

     5941 tttattaaac cccatacaag tgaaaatcct cttttacact gttcctttag gtgatcgcgg

     6001 agggacatta tgagtgaagt aaacctaaaa ggaaatacag atgaattagt gtattatcga

     6061 cagcaaacca ctggaaataa aatcgccagg aagagaatca aaaaagggaa agaagaagtt

     6121 tattatgttg ctgaaacgga agagaagata tggacagaag agcaaataaa aaacttttct

     6181 ttagacaaat ttggtacgca tataccttac atagaaggtc attatacaat cttaaataat

     6241 tacttctttg atttttgggg ctatttttta ggtgctgaag gaattgcgct ctatgctcac

     6301 ctaactcgtt atgcatacgg cagcaaagac ttttgctttc ctagtctaca aacaatcgct

     6361 aaaaaaatgg acaagactcc tgttacagtt agaggctact tgaaactgct tgaaaggtac

     6421 ggttttattt ggaaggtaaa cgtccgtaat aaaaccaagg ataacacaga ggaatccccg

     6481 atttttaaga ttagacgtaa ggttcctttg ctttcagaag aacttttaaa tggaaaccct

     6541 aatattgaaa ttccagatga cgaggaagca catgtaaaga aggctttaaa aaaggaaaaa

     6601 gagggtcttc caaaggtttt gaaaaaagag cacgatgaat ttgttaaaaa aatgatggat

     6661 gagtcagaaa caattaatat tccagaggcc ttacaatatg acacaatgta tgaagatata

     6721 ctcagtaaag gagaaattcg aaaagaaatc aaaaaacaaa tacctaatcc tacaacatct

     6781 tttgagagta tatcaatgac aactgaagag gaaaaagtcg acagtacttt aaaaagcgaa

     6841 atgcaaaatc gtgtctctaa gccttctttt gatacctggt ttaaaaacac taagatcaaa

     6901 attgaaaata aaaattgttt attacttgta ccgagtgaat ttgcatttga atggattaag

     6961 aaaagatatt tagaaacaat taaaacagtc cttgaagaag ctggatatgt tttcgaaaaa

     7021 atcgaactaa gaaaagtgca ataaactgct gaagtatttc agcagttttt tttatttaga

     7081 aatagtgaaa aaaatataat cagggaggta tcaatattta atgagtactg atttaaattt

     7141 atttagactg gaattaataa ttaacacgta gactaattaa aatttaatga gggataaaga

     7201 ggatacaaaa atattaattt caatccctat taaattttaa caaggggggg attaaaattt

     7261 aattagaggt ttatccacaa gaaaagaccc taataaaatt tttactaggg ttataacact

     7321 gattaatttc ttaatggggg agggattaaa atttaatgac aaagaaaaca atcttttaag

     7381 aaaagctttt aaaagataat aataaaaaga gctttgcgat taagcaaaac tctttacttt

     7441 ttcattgaca ttatcaaatt catcgatttc aaattgttgt tgtatcataa agttaattct

     7501 gttttgcaca accttttcag gaatataaaa cacatctgag gcttgtttta taaactcagg

     7561 gtcgctaaag tcaatgtaac gtagcatatg atatggtata gcttccaccc aagttagcct

     7621 ttctgcttct tctgaatgtt tttcatatac ttccatgggt atctctaaat gattttcctc

     7681 atgtagcaag gtatgagcaa aaagtttatg gaattgatag ttcctctctt tttcttcaac

     7741 ttttttatct aaaacaaaca ctttaacatc tgagtcaatg taagcataag atgtttttcc

     7801 agtcataatt tcaatcccaa atcttttaga cagaaattct ggacgtaaat cttttggtga

     7861 aagaattttt ttatgtagca atatatccga tacagcacct tctaaaagcg ttggtgaata

     7921 gggcatttta cctatctcct ctcattttgt ggaataaaaa tagtcatatt cgtccatcta

     7981 cctatcctat tatcgaacag ttgaactttt taatcaagga tcagtccttt ttttcattat

     8041 tcttaaactg tgctcttaac tttaacaact cgatttgttt ttccagatc

//

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart