pHelper

$136.00

  • Model: PVT2101
  • 48 Units in Stock
Ask a question


Add to Cart:

pHelper

PVT2101    2ug

 

pHelper Information

Replicator: pUC ori, F1 ori

Plasmid classification: virus series, adenovirus associated packaging vector

Plasmid size: 11635bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic, LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: primers designed according to sequence

3'sequencing primers: primers designed according to sequence

 

pHelper Description

pHelper is a vector of 11.6 KB, carries the adenovirus genes (E2A E4 and VA RNAs required inducing the lytic) for phase of AAV. This vector is cotransfected into the packaging cell line to produce recombinant replication-deficient AAV virions., it is related to packaging adenovirus vector with ampicillin resistance.

 

pHelper Sequence

LOCUS       Exported               11635 bp ds-DNA     circular SYN 15-AUG-2018

DEFINITION  synthetic circular DNA

KEYWORDS    pHelper

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 11635)

  AUTHORS   Triple Threat

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..11635

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    complement(1..5336)

                     /note="adeno E2A"

     misc_feature    5337..8537

                     /note="adeno E4"

     misc_feature    complement(8538..9280)

                     /note="adeno VA"

     rep_origin      complement(9423..10011)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(10182..11042)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(11043..11147)

                     /gene="bla"

                     /note="AmpR promoter"

     rep_origin      complement(11173..11627)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

ORIGIN

        1 ggtacccaac tccatgctta acagtcccca ggtacagccc accctgcgtc gcaaccagga

       61 acagctctac agcttcctgg agcgccactc gccctacttc cgcagccaca gtgcgcagat

      121 taggagcgcc acttcttttt gtcacttgaa aaacatgtaa aaataatgta ctaggagaca

      181 ctttcaataa aggcaaatgt ttttatttgt acactctcgg gtgattattt accccccacc

      241 cttgccgtct gcgccgttta aaaatcaaag gggttctgcc gcgcatcgct atgcgccact

      301 ggcagggaca cgttgcgata ctggtgttta gtgctccact taaactcagg cacaaccatc

      361 cgcggcagct cggtgaagtt ttcactccac aggctgcgca ccatcaccaa cgcgtttagc

      421 aggtcgggcg ccgatatctt gaagtcgcag ttggggcctc cgccctgcgc gcgcgagttg

      481 cgatacacag ggttgcagca ctggaacact atcagcgccg ggtggtgcac gctggccagc

      541 acgctcttgt cggagatcag atccgcgtcc aggtcctccg cgttgctcag ggcgaacgga

      601 gtcaactttg gtagctgcct tcccaaaaag ggtgcatgcc caggctttga gttgcactcg

      661 caccgtagtg gcatcagaag gtgaccgtgc ccggtctggg cgttaggata cagcgcctgc

      721 atgaaagcct tgatctgctt aaaagccacc tgagcctttg cgccttcaga gaagaacatg

      781 ccgcaagact tgccggaaaa ctgattggcc ggacaggccg cgtcatgcac gcagcacctt

      841 gcgtcggtgt tggagatctg caccacattt cggccccacc ggttcttcac gatcttggcc

      901 ttgctagact gctccttcag cgcgcgctgc ccgttttcgc tcgtcacatc catttcaatc

      961 acgtgctcct tatttatcat aatgctcccg tgtagacact taagctcgcc ttcgatctca

     1021 gcgcagcggt gcagccacaa cgcgcagccc gtgggctcgt ggtgcttgta ggttacctct

     1081 gcaaacgact gcaggtacgc ctgcaggaat cgccccatca tcgtcacaaa ggtcttgttg

     1141 ctggtgaagg tcagctgcaa cccgcggtgc tcctcgttta gccaggtctt gcatacggcc

     1201 gccagagctt ccacttggtc aggcagtagc ttgaagtttg cctttagatc gttatccacg

     1261 tggtacttgt ccatcaacgc gcgcgcagcc tccatgccct tctcccacgc agacacgatc

     1321 ggcaggctca gcgggtttat caccgtgctt tcactttccg cttcactgga ctcttccttt

     1381 tcctcttgcg tccgcatacc ccgcgccact gggtcgtctt cattcagccg ccgcaccgtg

     1441 cgcttacctc ccttgccgtg cttgattagc accggtgggt tgctgaaacc caccatttgt

     1501 agcgccacat cttctctttc ttcctcgctg tccacgatca cctctgggga tggcgggcgc

     1561 tcgggcttgg gagaggggcg cttctttttc tttttggacg caatggccaa atccgccgtc

     1621 gaggtcgatg gccgcgggct gggtgtgcgc ggcaccagcg catcttgtga cgagtcttct

     1681 tcgtcctcgg actcgagacg ccgcctcagc cgcttttttg ggggcgcgcg gggaggcggc

     1741 ggcgacggcg acggggacga cacgtcctcc atggttggtg gacgtcgcgc cgcaccgcgt

     1801 ccgcgctcgg gggtggtttc gcgctgctcc tcttcccgac tggccatttc cttctcctat

     1861 aggcagaaaa agatcatgga gtcagtcgag aaggaggaca gcctaaccgc cccctttgag

     1921 ttcgccacca ccgcctccac cgatgccgcc aacgcgccta ccaccttccc cgtcgaggca

     1981 cccccgcttg aggaggagga agtgattatc gagcaggacc caggttttgt aagcgaagac

     2041 gacgaggatc gctcagtacc aacagaggat aaaaagcaag accaggacga cgcagaggca

     2101 aacgaggaac aagtcgggcg gggggaccaa aggcatggcg actacctaga tgtgggagac

     2161 gacgtgctgt tgaagcatct gcagcgccag tgcgccatta tctgcgacgc gttgcaagag

     2221 cgcagcgatg tgcccctcgc catagcggat gtcagccttg cctacgaacg ccacctgttc

     2281 tcaccgcgcg taccccccaa acgccaagaa aacggcacat gcgagcccaa cccgcgcctc

     2341 aacttctacc ccgtatttgc cgtgccagag gtgcttgcca cctatcacat ctttttccaa

     2401 aactgcaaga tacccctatc ctgccgtgcc aaccgcagcc gagcggacaa gcagctggcc

     2461 ttgcggcagg gcgctgtcat acctgatatc gcctcgctcg acgaagtgcc aaaaatcttt

     2521 gagggtcttg gacgcgacga gaaacgcgcg gcaaacgctc tgcaacaaga aaacagcgaa

     2581 aatgaaagtc actgtggagt gctggtggaa cttgagggtg acaacgcgcg cctagccgtg

     2641 ctgaaacgca gcatcgaggt cacccacttt gcctacccgg cacttaacct accccccaag

     2701 gttatgagca cagtcatgag cgagctgatc gtgcgccgtg cacgacccct ggagagggat

     2761 gcaaacttgc aagaacaaac cgaggagggc ctacccgcag ttggcgatga gcagctggcg

     2821 cgctggcttg agacgcgcga gcctgccgac ttggaggagc gacgcaagct aatgatggcc

     2881 gcagtgcttg ttaccgtgga gcttgagtgc atgcagcggt tctttgctga cccggagatg

     2941 cagcgcaagc tagaggaaac gttgcactac acctttcgcc agggctacgt gcgccaggcc

     3001 tgcaaaattt ccaacgtgga gctctgcaac ctggtctcct accttggaat tttgcacgaa

     3061 aaccgcctcg ggcaaaacgt gcttcattcc acgctcaagg gcgaggcgcg ccgcgactac

     3121 gtccgcgact gcgtttactt atttctgtgc tacacctggc aaacggccat gggcgtgtgg

     3181 cagcaatgcc tggaggagcg caacctaaag gagctgcaga agctgctaaa gcaaaacttg

     3241 aaggacctat ggacggcctt caacgagcgc tccgtggccg cgcacctggc ggacattatc

     3301 ttccccgaac gcctgcttaa aaccctgcaa cagggtctgc cagacttcac cagtcaaagc

     3361 atgttgcaaa actttaggaa ctttatccta gagcgttcag gaattctgcc cgccacctgc

     3421 tgtgcgcttc ctagcgactt tgtgcccatt aagtaccgtg aatgccctcc gccgctttgg

     3481 ggtcactgct accttctgca gctagccaac taccttgcct accactccga catcatggaa

     3541 gacgtgagcg gtgacggcct actggagtgt cactgtcgct gcaacctatg caccccgcac

     3601 cgctccctgg tctgcaattc gcaactgctt agcgaaagtc aaattatcgg tacctttgag

     3661 ctgcagggtc cctcgcctga cgaaaagtcc gcggctccgg ggttgaaact cactccgggg

     3721 ctgtggacgt cggcttacct tcgcaaattt gtacctgagg actaccacgc ccacgagatt

     3781 aggttctacg aagaccaatc ccgcccgcca aatgcggagc ttaccgcctg cgtcattacc

     3841 cagggccaca tccttggcca attgcaagcc atcaacaaag cccgccaaga gtttctgcta

     3901 cgaaagggac ggggggttta cctggacccc cagtccggcg aggagctcaa cccaatcccc

     3961 ccgccgccgc agccctatca gcagccgcgg gcccttgctt cccaggatgg cacccaaaaa

     4021 gaagctgcag ctgccgccgc cgccacccac ggacgaggag gaatactggg acagtcaggc

     4081 agaggaggtt ttggacgagg aggaggagat gatggaagac tgggacagcc tagacgaagc

     4141 ttccgaggcc gaagaggtgt cagacgaaac accgtcaccc tcggtcgcat tcccctcgcc

     4201 ggcgccccag aaattggcaa ccgttcccag catcgctaca acctccgctc ctcaggcgcc

     4261 gccggcactg cctgttcgcc gacccaaccg tagatgggac accactggaa ccagggccgg

     4321 taagtctaag cagccgccgc cgttagccca agagcaacaa cagcgccaag gctaccgctc

     4381 gtggcgcggg cacaagaacg ccatagttgc ttgcttgcaa gactgtgggg gcaacatctc

     4441 cttcgcccgc cgctttcttc tctaccatca cggcgtggcc ttcccccgta acatcctgca

     4501 ttactaccgt catctctaca gcccctactg caccggcggc agcggcagcg gcagcaacag

     4561 cagcggtcac acagaagcaa aggcgaccgg atagcaagac tctgacaaag cccaagaaat

     4621 ccacagcggc ggcagcagca ggaggaggag cgctgcgtct ggcgcccaac gaacccgtat

     4681 cgacccgcga gcttagaaat aggatttttc ccactctgta tgctatattt caacaaagca

     4741 ggggccaaga acaagagctg aaaataaaaa acaggtctct gcgctccctc acccgcagct

     4801 gcctgtatca caaaagcgaa gatcagcttc ggcgcacgct ggaagacgcg gaggctctct

     4861 tcagcaaata ctgcgcgctg actcttaagg actagtttcg cgccctttct caaatttaag

     4921 cgcgaaaact acgtcatctc cagcggccac acccggcgcc agcacctgtc gtcagcgcca

     4981 ttatgagcaa ggaaattccc acgccctaca tgtggagtta ccagccacaa atgggacttg

     5041 cggctggagc tgcccaagac tactcaaccc gaataaacta catgagcgcg ggaccccaca

     5101 tgatatcccg ggtcaacgga atccgcgccc accgaaaccg aattctcctc gaacaggcgg

     5161 ctattaccac cacacctcgt aataacctta atccccgtag ttggcccgct gccctggtgt

     5221 accaggaaag tcccgctccc accactgtgg tacttcccag agacgcccag gccgaagttc

     5281 agatgactaa ctcaggggcg cagcttgcgg gcggctttcg tcacagggtg cggtcgcccg

     5341 ggcgttttag ggcggagtaa cttgcatgta ttgggaattg tagttttttt aaaatgggaa

     5401 gtgacgtatc gtgggaaaac ggaagtgaag atttgaggaa gttgtgggtt ttttggcttt

     5461 cgtttctggg cgtaggttcg cgtgcggttt tctgggtgtt ttttgtggac tttaaccgtt

     5521 acgtcatttt ttagtcctat atatactcgc tctgtacttg gcccttttta cactgtgact

     5581 gattgagctg gtgccgtgtc gagtggtgtt ttttaatagg tttttttact ggtaaggctg

     5641 actgttatgg ctgccgctgt ggaagcgctg tatgttgttc tggagcggga gggtgctatt

     5701 ttgcctaggc aggagggttt ttcaggtgtt tatgtgtttt tctctcctat taattttgtt

     5761 atacctccta tgggggctgt aatgttgtct ctacgcctgc gggtatgtat tcccccgggc

     5821 tatttcggtc gctttttagc actgaccgat gttaaccaac ctgatgtgtt taccgagtct

     5881 tacattatga ctccggacat gaccgaggaa ctgtcggtgg tgctttttaa tcacggtgac

     5941 cagttttttt acggtcacgc cggcatggcc gtagtccgtc ttatgcttat aagggttgtt

     6001 tttcctgttg taagacaggc ttctaatgtt taaatgtttt tttttttgtt attttatttt

     6061 gtgtttaatg caggaacccg cagacatgtt tgagagaaaa atggtgtctt tttctgtggt

     6121 ggttccggaa cttacctgcc tttatctgca tgagcatgac tacgatgtgc ttgctttttt

     6181 gcgcgaggct ttgcctgatt ttttgagcag caccttgcat tttatatcgc cgcccatgca

     6241 acaagcttac ataggggcta cgctggttag catagctccg agtatgcgtg tcataatcag

     6301 tgtgggttct tttgtcatgg ttcctggcgg ggaagtggcc gcgctggtcc gtgcagacct

     6361 gcacgattat gttcagctgg ccctgcgaag ggacctacgg gatcgcggta tttttgttaa

     6421 tgttccgctt ttgaatctta tacaggtctg tgaggaacct gaatttttgc aatcatgatt

     6481 cgctgcttga ggctgaaggt ggagggcgct ctggagcaga tttttacaat ggccggactt

     6541 aatattcggg atttgcttag agacatattg ataaggtggc gagatgaaaa ttatttgggc

     6601 atggttgaag gtgctggaat gtttatagag gagattcacc ctgaagggtt tagcctttac

     6661 gtccacttgg acgtgagggc agtttgcctt ttggaagcca ttgtgcaaca tcttacaaat

     6721 gccattatct gttctttggc tgtagagttt gaccacgcca ccggagggga gcgcgttcac

     6781 ttaatagatc ttcattttga ggttttggat aatcttttgg aataaaaaaa aaaaaacatg

     6841 gttcttccag ctcttcccgc tcctcccgtg tgtgactcgc agaacgaatg tgtaggttgg

     6901 ctgggtgtgg cttattctgc ggtggtggat gttatcaggg cagcggcgca tgaaggagtt

     6961 tacatagaac ccgaagccag ggggcgcctg gatgctttga gagagtggat atactacaac

     7021 tactacacag agcgagctaa gcgacgagac cggagacgca gatctgtttg tcacgcccgc

     7081 acctggtttt gcttcaggaa atatgactac gtccggcgtt ccatttggca tgacactacg

     7141 accaacacga tctcggttgt ctcggcgcac tccgtacagt agggatcgcc tacctccttt

     7201 tgagacagag acccgcgcta ccatactgga ggatcatccg ctgctgcccg aatgtaacac

     7261 tttgacaatg cacaacgtga gttacgtgcg aggtcttccc tgcagtgtgg gatttacgct

     7321 gattcaggaa tgggttgttc cctgggatat ggttctgacg cgggaggagc ttgtaatcct

     7381 gaggaagtgt atgcacgtgt gcctgtgttg tgccaacatt gatatcatga cgagcatgat

     7441 gatccatggt tacgagtcct gggctctcca ctgtcattgt tccagtcccg gttccctgca

     7501 gtgcatagcc ggcgggcagg ttttggccag ctggtttagg atggtggtgg atggcgccat

     7561 gtttaatcag aggtttatat ggtaccggga ggtggtgaat tacaacatgc caaaagaggt

     7621 aatgtttatg tccagcgtgt ttatgagggg tcgccactta atctacctgc gcttgtggta

     7681 tgatggccac gtgggttctg tggtccccgc catgagcttt ggatacagcg ccttgcactg

     7741 tgggattttg aacaatattg tggtgctgtg ctgcagttac tgtgctgatt taagtgagat

     7801 cagggtgcgc tgctgtgccc ggaggacaag gcgtctcatg ctgcgggcgg tgcgaatcat

     7861 cgctgaggag accactgcca tgttgtattc ctgcaggacg gagcggcggc ggcagcagtt

     7921 tattcgcgcg ctgctgcagc accaccgccc tatcctgatg cacgattatg actctacccc

     7981 catgtaggcg tggacttccc cttcgccgcc cgttgagcaa ccgcaagttg gacagcagcc

     8041 tgtggctcag cagctggaca gcgacatgaa cttaagcgag ctgcccgggg agtttattaa

     8101 tatcactgat gagcgtttgg ctcgacagga aaccgtgtgg aatataacac ctaagaatat

     8161 gtctgttacc catgatatga tgctttttaa ggccagccgg ggagaaagga ctgtgtactc

     8221 tgtgtgttgg gagggaggtg gcaggttgaa tactagggtt ctgtgagttt gattaaggta

     8281 cggtgatcaa tataagctat gtggtggtgg ggctatacta ctgaatgaaa aatgacttga

     8341 aattttctgc aattgaaaaa taaacacgtt gaaacataac atgcaacagg ttcacgattc

     8401 tttattcctg ggcaatgtag gagaaggtgt aagagttggt agcaaaagtt tcagtggtgt

     8461 attttccact ttcccaggac catgtaaaag acatagagta agtgcttacc tcgctagttt

     8521 ctgtggattc actagaatcg atgtaggatg ttgcccctcc tgacgcggta ggagaagggg

     8581 agggtgccct gcatgtctgc cgctgctctt gctcttgccg ctgctgagga ggggggcgca

     8641 tctgccgcag caccggatgc atctgggaaa agcaaaaaag gggctcgtcc ctgtttccgg

     8701 aggaatttgc aagcggggtc ttgcatgacg gggaggcaaa cccccgttcg ccgcagtccg

     8761 gccggcccga gactcgaacc gggggtcctg cgactcaacc cttggaaaat aaccctccgg

     8821 ctacagggag cgagccactt aatgctttcg ctttccagcc taaccgctta cgccgcgcgc

     8881 ggccagtggc caaaaaagct agcgcagcag ccgccgcgcc tggaaggaag ccaaaaggag

     8941 cgctcccccg ttgtctgacg tcgcacacct gggttcgaca cgcgggcggt aaccgcatgg

     9001 atcacggcgg acggccggat ccggggttcg aaccccggtc gtccgccatg atacccttgc

     9061 gaatttatcc accagaccac ggaagagtgc ccgcttacag gctctccttt tgcacggtct

     9121 agagcgtcaa cgactgcgca cgcctcaccg gccagagcgt cccgaccatg gagcactttt

     9181 tgccgctgcg caacatctgg aaccgcgtcc gcgactttcc gcgcgcctcc accaccgccg

     9241 ccggcatcac ctggatgtcc aggtacatct acggattacg tcgacgttta aaccatatga

     9301 tcagctcact caaaggcggt aatacggtta tccacagaat caggggataa cgcaggaaag

     9361 aacatgtgag caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg

     9421 tttttccata ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg

     9481 tggcgaaacc cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg

     9541 cgctctcctg ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga

     9601 agcgtggcgc tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc

     9661 tccaagctgg gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt

     9721 aactatcgtc ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact

     9781 ggtaacagga ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg

     9841 cctaactacg gctacactag aagaacagta tttggtatct gcgctctgct gaagccagtt

     9901 accttcggaa aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt

     9961 ggtttttttg tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct

    10021 ttgatctttt ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg

    10081 gtcatgagat tatcaaaaag gatcttcacc tagatccttt taaattaaaa atgaagtttt

    10141 aaatcaatct aaagtatata tgagtaaact tggtctgaca gttaccaatg cttaatcagt

    10201 gaggcaccta tctcagcgat ctgtctattt cgttcatcca tagttgcctg actccccgtc

    10261 gtgtagataa ctacgatacg ggagggctta ccatctggcc ccagtgctgc aatgataccg

    10321 cgagacccac gctcaccggc tccagattta tcagcaataa accagccagc cggaagggcc

    10381 gagcgcagaa gtggtcctgc aactttatcc gcctccatcc agtctattaa ttgttgccgg

    10441 gaagctagag taagtagttc gccagttaat agtttgcgca acgttgttgc cattgctaca

    10501 ggcatcgtgg tgtcacgctc gtcgtttggt atggcttcat tcagctccgg ttcccaacga

    10561 tcaaggcgag ttacatgatc ccccatgttg tgcaaaaaag cggttagctc cttcggtcct

    10621 ccgatcgttg tcagaagtaa gttggccgca gtgttatcac tcatggttat ggcagcactg

    10681 cataattctc ttactgtcat gccatccgta agatgctttt ctgtgactgg tgagtactca

    10741 accaagtcat tctgagaata gtgtatgcgg cgaccgagtt gctcttgccc ggcgtcaata

    10801 cgggataata ccgcgccaca tagcagaact ttaaaagtgc tcatcattgg aaaacgttct

    10861 tcggggcgaa aactctcaag gatcttaccg ctgttgagat ccagttcgat gtaacccact

    10921 cgtgcaccca actgatcttc agcatctttt actttcacca gcgtttctgg gtgagcaaaa

    10981 acaggaaggc aaaatgccgc aaaaaaggga ataagggcga cacggaaatg ttgaatactc

    11041 atactcttcc tttttcaata ttattgaagc atttatcagg gttattgtct catgagcgga

    11101 tacatatttg aatgtattta gaaaaataaa caaatagggg ttccgcgcac atttccccga

    11161 aaagtgccac ctaaattgta agcgttaata ttttgttaaa attcgcgtta aatttttgtt

    11221 aaatcagctc attttttaac caataggccg aaatcggcaa aatcccttat aaatcaaaag

    11281 aatagaccga gatagggttg agtgttgttc cagtttggaa caagagtcca ctattaaaga

    11341 acgtggactc caacgtcaaa gggcgaaaaa ccgtctatca gggcgatggc ccactacgtg

    11401 aaccatcacc ctaatcaagt tttttggggt cgaggtgccg taaagcacta aatcggaacc

    11461 ctaaagggag cccccgattt agagcttgac ggggaaagcc ggcgaacgtg gcgagaaagg

    11521 aagggaagaa agcgaaagga gcgggcgcta gggcgctggc aagtgtagcg gtcacgctgc

    11581 gcgtaaccac cacacccgcc gcgcttaatg cgccgctaca gggcgcgatg gatcc

//

Caution:
Product is for research use only!

 

Search name

pHelper,Plasmid pHelper,pHelper vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart