pHIV- H2BmRFP

$215.00

  • Model: PVT11082
  • 50 Units in Stock
Ask a question


Add to Cart:

pHIV-H2BmRFP


Catalog No. PVT11082
Packing 2ug
Function /
Resistance Amp
Screen /
Strain Stbl3
Culture temperature 37degrees centigrade
Replicon pUC
Copy
Promoter PGK,CMV
Induction --
Forward primer CMV-F
Reverse primer

 

pHIV-H2BmRFP Information

Promoter: EF-1 alpha, CMV

Replicon: pUC ori

Plasmid classification: virus series, lentivirus cloning vector

Plasmid size: 8045bp

Prokaryotic resistance: Amp

Cloned strain: Stbl3

Culture conditions: 37 centigrade, aerobic LB

Expression host: mammalian cells

Induction mode: no induction, instantaneous expression

5'sequencing primers: CMV-F:CGCAAATGGGCGGTAGGCGTG

3'sequencing primers: primers designed according to sequence

 

pHIV-H2BmRFP Description

PHIV-H2BmRFP background vector HIV-Zsgreen, which is a high copy plasmid, is a slow virus vector, in the transformation of the cloned strain is Stbl3, at 37 C. The culture of the plasmid containing ampicillin.

 

pHIV-H2BmRFP Sequence

  LOCUS       Exported                8045 bp ds-DNA     circular SYN 30-AUG-2016    DEFINITION  synthetic circular DNA    ACCESSION   .    VERSION     .    KEYWORDS    Untitled 6    SOURCE      synthetic DNA construct      ORGANISM  synthetic DNA construct    REFERENCE   1  (bases 1 to 8045)      AUTHORS   .      TITLE     Direct Submission      JOURNAL   Exported Tuesday, August 30, 2016 from SnapGene Viewer 3.1.4                   FEATURES             Location/Qualifiers         source          1..8045                         /organism="synthetic DNA construct"                         /mol_type="other DNA"         enhancer        238..617                         /note="CMV enhancer"                         /note="human cytomegalovirus immediate early enhancer"         promoter        619..817                         /note="CMV promoter"                         /note="human cytomegalovirus (CMV) immediate early                          promoter"         LTR             835..1015                         /note="5' LTR (truncated)"                         /note="truncated 5' long terminal repeat (LTR) from HIV-1"         misc_feature    1062..1187                         /note="HIV-1 Psi"                         /note="packaging signal of human immunodeficiency virus                          type 1"         misc_feature    1686..1919                         /note="RRE"                         /note="The Rev response element (RRE) of HIV-1 allows for                          Rev-dependent mRNA export from the nucleus to the                          cytoplasm."         misc_feature    2446..2563                         /note="cPPT/CTS"                         /note="central polypurine tract and central termination                          sequence of HIV-1"         promoter        2627..3805                         /note="EF-1-alpha promoter"                         /note="strong constitutive promoter for human elongation                          factor EF-1-alpha"         intron          2858..3796                         /note="EF-1-alpha intron A"                         /note="intron upstream of the start codon of human                          EF-1-alpha"         misc_feature    3851..4437                         /note="IRES2"                         /note="internal ribosome entry site (IRES) of the                          encephalomyocarditis virus (EMCV)"         CDS             4837..5514                         /codon_start=1                         /product="monomeric derivative of DsRed (Campbell et al.,                          2002)"                         /note="mRFP1"                         /note="mammalian codon-optimized"                         /translation="MASSEDVIKEFMRFKVRMEGSVNGHEFEIEGEGEGRPYEGTQTAK                         LKVTKGGPLPFAWDILSPQFQYGSKAYVKHPADIPDYLKLSFPEGFKWERVMNFEDGGV                         VTVTQDSSLQDGEFIYKVKLRGTNFPSDGPVMQKKTMGWEASTERMYPEDGALKGEIKM                         RLKLKDGGHYDAEVKTTYMAKKPVQLPGAYKTDIKLDITSHNEDYTIVEQYERAEGRHS                         TGA"         primer_bind     complement(5525..5541)                         /note="KS primer"                         /note="common sequencing primer, one of multiple similar                          variants"         LTR             6051..6231                         /note="5' LTR (truncated)"                         /note="truncated 5' long terminal repeat (LTR) from HIV-1"         rep_origin      complement(6293..6881)                         /direction=LEFT                         /note="ori"                         /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of                          replication"         CDS             complement(7052..7912)                         /codon_start=1                         /gene="bla"                         /product="beta-lactamase"                         /note="AmpR"                         /note="confers resistance to ampicillin, carbenicillin, and                         related antibiotics"                         /translation="[TEM beta-lactamase fragment, 45 aa]                         ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS                         PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW                         EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA                         LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS                         LIKHW"         promoter        complement(7913..8017)                         /gene="bla"                         /note="AmpR promoter"    ORIGIN            1 gtcgacggat cgggagatct cccgatcccc tatggtgcac tctcagtaca atctgctctg           61 atgccgcata gttaagccag tatctgctcc ctgcttgtgt gttggaggtc gctgagtagt          121 gcgcgagcaa aatttaagct acaacaaggc aaggcttgac cgacaattgc atgaagaatc          181 tgcttagggt taggcgtttt gcgctgcttc gcgatgtacg ggccagatat acgcgttgac          241 attgattatt gactagttat taatagtaat caattacggg gtcattagtt catagcccat          301 atatggagtt ccgcgttaca taacttacgg taaatggccc gcctggctga ccgcccaacg          361 acccccgccc attgacgtca ataatgacgt atgttcccat agtaacgcca atagggactt          421 tccattgacg tcaatgggtg gagtatttac ggtaaactgc ccacttggca gtacatcaag          481 tgtatcatat gccaagtacg ccccctattg acgtcaatga cggtaaatgg cccgcctggc          541 attatgccca gtacatgacc ttatgggact ttcctacttg gcagtacatc tacgtattag          601 tcatcgctat taccatggtg atgcggtttt ggcagtacat caatgggcgt ggatagcggt          661 ttgactcacg gggatttcca agtctccacc ccattgacgt caatgggagt ttgttttggc          721 accaaaatca acgggacttt ccaaaatgtc gtaacaactc cgccccattg acgcaaatgg          781 gcggtaggcg tgtacggtgg gaggtctata taagcagcgc gttttgcctg tactgggtct          841 ctctggttag accagatctg agcctgggag ctctctggct aactagggaa cccactgctt          901 aagcctcaat aaagcttgcc ttgagtgctt caagtagtgt gtgcccgtct gttgtgtgac          961 tctggtaact agagatccct cagacccttt tagtcagtgt ggaaaatctc tagcagtggc         1021 gcccgaacag ggacttgaaa gcgaaaggga aaccagagga gctctctcga cgcaggactc         1081 ggcttgctga agcgcgcacg gcaagaggcg aggggcggcg actggtgagt acgccaaaaa         1141 ttttgactag cggaggctag aaggagagag atgggtgcga gagcgtcagt attaagcggg         1201 ggagaattag atcgcgatgg gaaaaaattc ggttaaggcc agggggaaag aaaaaatata         1261 aattaaaaca tatagtatgg gcaagcaggg agctagaacg attcgcagtt aatcctggcc         1321 tgttagaaac atcagaaggc tgtagacaaa tactgggaca gctacaacca tcccttcaga         1381 caggatcaga agaacttaga tcattatata atacagtagc aaccctctat tgtgtgcatc         1441 aaaggataga gataaaagac accaaggaag ctttagacaa gatagaggaa gagcaaaaca         1501 aaagtaagac caccgcacag caagcggccg gccgcgctga tcttcagacc tggaggagga         1561 gatatgaggg acaattggag aagtgaatta tataaatata aagtagtaaa aattgaacca         1621 ttaggagtag cacccaccaa ggcaaagaga agagtggtgc agagagaaaa aagagcagtg         1681 ggaataggag ctttgttcct tgggttcttg ggagcagcag gaagcactat gggcgcagcg         1741 tcaatgacgc tgacggtaca ggccagacaa ttattgtctg gtatagtgca gcagcagaac         1801 aatttgctga gggctattga ggcgcaacag catctgttgc aactcacagt ctggggcatc         1861 aagcagctcc aggcaagaat cctggctgtg gaaagatacc taaaggatca acagctcctg         1921 gggatttggg gttgctctgg aaaactcatt tgcaccactg ctgtgccttg gaatgctagt         1981 tggagtaata aatctctgga acagatttgg aatcacacga cctggatgga gtgggacaga         2041 gaaattaaca attacacaag cttaatacac tccttaattg aagaatcgca aaaccagcaa         2101 gaaaagaatg aacaagaatt attggaatta gataaatggg caagtttgtg gaattggttt         2161 aacataacaa attggctgtg gtatataaaa ttattcataa tgatagtagg aggcttggta         2221 ggtttaagaa tagtttttgc tgtactttct atagtgaata gagttaggca gggatattca         2281 ccattatcgt ttcagaccca cctcccaacc ccgaggggac ccgacaggcc cgaaggaata         2341 gaagaagaag gtggagagag agacagagac agatccattc gattagtgaa cggatcggca         2401 ctgcgtgcgc caattctgca gacaaatggc agtattcatc cacaatttta aaagaaaagg         2461 ggggattggg gggtacagtg caggggaaag aatagtagac ataatagcaa cagacataca         2521 aactaaagaa ttacaaaaac aaattacaaa aattcaaaat tttcgggttt attacaggga         2581 cagcagagat ccagtttggt tagtaccggg cccgctctag ccgtgaggct ccggtgcccg         2641 tcagtgggca gagcgcacat cgcccacagt ccccgagaag ttggggggag gggtcggcaa         2701 ttgaaccggt gcctagagaa ggtggcgcgg ggtaaactgg gaaagtgatg tcgtgtactg         2761 gctccgcctt tttcccgagg gtgggggaga accgtatata agtgcagtag tcgccgtgaa         2821 cgttcttttt cgcaacgggt ttgccgccag aacacaggta agtgccgtgt gtggttcccg         2881 cgggcctggc ctctttacgg gttatggccc ttgcgtgcct tgaattactt ccacctggct         2941 gcagtacgtg attcttgatc ccgagcttcg ggttggaagt gggtgggaga gttcgaggcc         3001 ttgcgcttaa ggagcccctt cgcctcgtgc ttgagttgag gcctggcctg ggcgctgggg         3061 ccgccgcgtg cgaatctggt ggcaccttcg cgcctgtctc gctgctttcg ataagtctct         3121 agccatttaa aatttttgat gacctgctgc gacgcttttt ttctggcaag atagtcttgt         3181 aaatgcgggc caagatctgc acactggtat ttcggttttt ggggccgcgg gcggcgacgg         3241 ggcccgtgcg tcccagcgca catgttcggc gaggcggggc ctgcgagcgc ggccaccgag         3301 aatcggacgg gggtagtctc aagctggccg gcctgctctg gtgcctggcc tcgcgccgcc         3361 gtgtatcgcc ccgccctggg cggcaaggct ggcccggtcg gcaccagttg cgtgagcgga         3421 aagatggccg cttcccggcc ctgctgcagg gagctcaaaa tggaggacgc ggcgctcggg         3481 agagcgggcg ggtgagtcac ccacacaaag gaaaagggcc tttccgtcct cagccgtcgc         3541 ttcatgtgac tccacggagt accgggcgcc gtccaggcac ctcgattagt tctcgagctt         3601 ttggagtacg tcgtctttag gttgggggga ggggttttat gcgatggagt ttccccacac         3661 tgagtgggtg gagactgaag ttaggccagc ttggcacttg atgtaattct ccttggaatt         3721 tgcccttttt gagtttggat cttggttcat tctcaagcct cagacagtgg ttcaaagttt         3781 ttttcttcca tttcaggtgt cgtgagcggc cgctgagtta actattctag agtacccggg         3841 ctaggatccg cccctctccc tccccccccc ctaacgttac tggccgaagc cgcttggaat         3901 aaggccggtg tgcgtttgtc tatatgttat tttccaccat attgccgtct tttggcaatg         3961 tgagggcccg gaaacctggc cctgtcttct tgacgagcat tcctaggggt ctttcccctc         4021 tcgccaaagg aatgcaaggt ctgttgaatg tcgtgaagga agcagttcct ctggaagctt         4081 cttgaagaca aacaacgtct gtagcgaccc tttgcaggca gcggaacccc ccacctggcg         4141 acaggtgcct ctgcggccaa aagccacgtg tataagatac acctgcaaag gcggcacaac         4201 cccagtgcca cgttgtgagt tggatagttg tggaaagagt caaatggctc tcctcaagcg         4261 tattcaacaa ggggctgaag gatgcccaga aggtacccca ttgtatggga tctgatctgg         4321 ggcctcggtg cacatgcttt acatgtgttt agtcgaggtt aaaaaaacgt ctaggccccc         4381 cgaaccacgg ggacgtggtt ttcctttgaa aaacacgatg ataatatggc cacaaccatg         4441 tcaccagagc cagcgaagtc tgctcccgcc ccgaaaaagg gctccaagaa ggcggtgact         4501 aaggcgcaga agaaaggcgg caagaagcgc aagcgcagcc gcaaggagag ctattccatc         4561 tatgtgtaca aggttctgaa gcaggtccac cctgacaccg gcatttcgtc caaggccatg         4621 ggcatcatga attcgtttgt gaacgacatt ttcgagcgca tcgcaggtga ggcttcccgc         4681 ctggcgcatt acaacaagcg ctcgaccatc acctccaggg agatccagac ggccgtgcgc         4741 ctgctgctgc ctggggagtt ggccaagcac gccgtgtccg agggtactaa ggccatcacc         4801 aagtacacca gcgctaagga tccaccggtc gccaccatgg cctcctccga ggacgtcatc         4861 aaggagttca tgcgcttcaa ggtgcgcatg gagggctccg tgaacggcca cgagttcgag         4921 atcgagggcg agggcgaggg ccgcccctac gagggcaccc agaccgccaa gctgaaggtg         4981 accaagggcg gccccctgcc cttcgcctgg gacatcctgt cccctcagtt ccagtacggc         5041 tccaaggcct acgtgaagca ccccgccgac atccccgact acttgaagct gtccttcccc         5101 gagggcttca agtgggagcg cgtgatgaac ttcgaggacg gcggcgtggt gaccgtgacc         5161 caggactcct ccctgcagga cggcgagttc atctacaagg tgaagctgcg cggcaccaac         5221 ttcccctccg acggccccgt aatgcagaag aagaccatgg gctgggaggc ctccaccgag         5281 cggatgtacc ccgaggacgg cgccctgaag ggcgagatca agatgaggct gaagctgaag         5341 gacggcggcc actacgacgc cgaggtcaag accacctaca tggccaagaa gcccgtgcag         5401 ctgcccggcg cctacaagac cgacatcaag ctggacatca cctcccacaa cgaggactac         5461 accatcgtgg aacagtacga gcgcgccgag ggccgccact ccaccggcgc ctaagcggcc         5521 gcatcgatac cgtcgacctc gatcgagacc tagaaaaaca tggagcaatc acaagtagca         5581 atacagcagc taccaatgct gattgtgcct ggctagaagc acaagaggag gaggaggtgg         5641 gttttccagt cacacctcag gtacctttaa gaccaatgac ttacaaggca gctgtagatc         5701 ttagccactt tttaaaagaa aaggggggac tggaagggct aattcactcc caacgaagac         5761 aagatatcct tgatctgtgg atctaccaca cacaaggcta cttccctgat tggcagaact         5821 acacaccagg gccagggatc agatatccac tgacctttgg atggtgctac aagctagtac         5881 cagttgagca agagaaggta gaagaagcca atgaaggaga gaacacccgc ttgttacacc         5941 ctgtgagcct gcatgggatg gatgacccgg agagagaagt attagagtgg aggtttgaca         6001 gccgcctagc atttcatcac atggcccgag agctgcatcc ggactgtact gggtctctct         6061 ggttagacca gatctgagcc tgggagctct ctggctaact agggaaccca ctgcttaagc         6121 ctcaataaag cttgccttga gtgcttcaag tagtgtgtgc ccgtctgttg tgtgactctg         6181 gtaactagag atccctcaga cccttttagt cagtgtggaa aatctctagc agcatgtgag         6241 caaaaggcca gcaaaaggcc aggaaccgta aaaaggccgc gttgctggcg tttttccata         6301 ggctccgccc ccctgacgag catcacaaaa atcgacgctc aagtcagagg tggcgaaacc         6361 cgacaggact ataaagatac caggcgtttc cccctggaag ctccctcgtg cgctctcctg         6421 ttccgaccct gccgcttacc ggatacctgt ccgcctttct cccttcggga agcgtggcgc         6481 tttctcatag ctcacgctgt aggtatctca gttcggtgta ggtcgttcgc tccaagctgg         6541 gctgtgtgca cgaacccccc gttcagcccg accgctgcgc cttatccggt aactatcgtc         6601 ttgagtccaa cccggtaaga cacgacttat cgccactggc agcagccact ggtaacagga         6661 ttagcagagc gaggtatgta ggcggtgcta cagagttctt gaagtggtgg cctaactacg         6721 gctacactag aagaacagta tttggtatct gcgctctgct gaagccagtt accttcggaa         6781 aaagagttgg tagctcttga tccggcaaac aaaccaccgc tggtagcggt ggtttttttg         6841 tttgcaagca gcagattacg cgcagaaaaa aaggatctca agaagatcct ttgatctttt         6901 ctacggggtc tgacgctcag tggaacgaaa actcacgtta agggattttg gtcatgagat         6961 tatcaaaaag gatcttcacc tagatccttt taaattaaaa atgaagtttt aaatcaatct         7021 aaagtatata tgagtaaact tggtctgaca gttaccaatg cttaatcagt gaggcaccta         7081 tctcagcgat ctgtctattt cgttcatcca tagttgcctg actccccgtc gtgtagataa         7141 ctacgatacg ggagggctta ccatctggcc ccagtgctgc aatgataccg cgagacccac         7201 gctcaccggc tccagattta tcagcaataa accagccagc cggaagggcc gagcgca
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart