pHT43

$216.00

  • Model: PVT5007
  • 49 Units in Stock
Ask a question


Add to Cart:

pHT43

PVT5007    Packing 2ug

 

pHT43 Information

Alias: pHT-43

Promoter: pgrac

Replicon: pUC

Plasmid classification: broad host series, Bacillus subtilis vector

Plasmid size: 8057 bp

Prokaryotic resistance: Amp

Eukaryotic resistance: Chl

Clone strain: DH5a

Culture conditions: 37 degrees

Expression host: Bacillus subtilis

Induction mode: IPTG induction

5 'sequencing primers: primers were designed according to the sequences

3 'sequencing primers: primers were designed according to the sequence

Plasmid host: Bacillus subtilis

Purpose of plasmid: protein expression

Fragment type: ORF

Fragment species: empty bodies

Prokaryotic resistance: Amp

 

pHT43 Description

pHT43-plasmid

 

 

pHT43 Sequence

LOCUS       Exported File           8057 bp ds-DNA    circular SYN 07-2-2015

DEFINITION  .

ACCESSION   .

VERSION     .

KEYWORDS    pHT43

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 8057)

  AUTHORS   .

  TITLE     Direct Submission

  JOURNAL   Exported 2015-2-7 

       

FEATURES             Location/Qualifiers

     source          1..8057

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     primer_bind     1238..1254

                     /note="M13 fwd"

                     /note="common sequencing primer, one of multiple similar 

                     variants"

     CDS             complement(1297..2379)

                     /codon_start=1

                     /gene="lacI"

                     /product="lac repressor"

                     /note="lacI"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

                     /translation="MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAEL

                     NYIPNRVAQQLAGKQSLLIGVATSSLALHAPSQIVAAIKSRADQLGASVVVSMVERSGV

                     EACKAAVHNLLAQRVSGLIINYPLDDQDAIAVEAACTNVPALFLDVSDQTPINSIIFSH

                     EDGTRLGVEHLVALGHQQIALLAGPLSSVSARLRLAGWHKYLTRNQIQPIAEREGDWSA

                     MSGFQQTMQMLNEGIVPTAMLVANDQMALGAMRAITESGLRVGADISVVGYDDTEDSSC

                     YIPPSTTIKQDFRLLGQTSVDRLLQLSQGQAVKGNQLLPVSLVKRKTTLAPNTQTASPR

                     ALADSLMQLARQVSRLESGQ"

     protein_bind    2763..2787

                     /bound_moiety="lac repressor encoded by lacI"

                     /note="lac operator"

                     /note="The lac repressor binds to the lac operator to 

                     inhibit transcription in E. coli. This inhibition can be 

                     relieved by adding lactose or 

                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."

     promoter        6134..6238

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             6239..7099

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     [TEM beta-lactamase fragment, 59 aa]

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     [TEM beta-lactamase fragment, 59 aa]

                     LIKHW"

     rep_origin      7270..7858

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 ttaagttatt ggtatgactg gttttaagcg caaaaaaagt tgctttttcg tacctattaa

       61 tgtatcgttt tagaaaaccg actgtaaaaa gtacagtcgg cattatctca tattataaaa

      121 gccagtcatt aggcctatct gacaattcct gaatagagtt cataaacaat cctgcatgat

      181 aaccatcaca aacagaatga tgtacctgta aagatagcgg taaatatatt gaattacctt

      241 tattaatgaa ttttcctgct gtaataatgg gtagaaggta attactatta ttattgatat

      301 ttaagttaaa cccagtaaat gaagtccatg gaataataga aagagaaaaa gcattttcag

      361 gtataggtgt tttgggaaac aatttccccg aaccattata tttctctaca tcagaaaggt

      421 ataaatcata aaactctttg aagtcattct ttacaggagt ccaaatacca gagaatgttt

      481 tagatacacc atcaaaaatt gtataaagtg gctctaactt atcccaataa cctaactctc

      541 cgtcgctatt gtaaccagtt ctaaaagctg tatttgagtt tatcaccctt gtcactaaga

      601 aaataaatgc agggtaaaat ttatatcctt cttgttttat gtttcggtat aaaacactaa

      661 tatcaatttc tgtggttata ctaaaagtcg tttgttggtt caaataatga ttaaatatct

      721 cttttctctt ccaattgtct aaatcaattt tattaaagtt catttgatat gcctcctaaa

      781 tttttatcta aagtgaattt aggaggctta cttgtctgct ttcttcatta gaatcaatcc

      841 ttttttaaaa gtcaatatta ctgtaacata aatatatatt ttaaaaatat cccactttat

      901 ccaattttcg tttgttgaac taatgggtgc tttagttgaa gaataaagac cacattaaaa

      961 aatgtggtct tttgtgtttt tttaaaggat ttgagcgtag cgaaaaatcc ttttctttct

     1021 tatcttgata ataagggtaa ctattgccga tcgtccattc cgacagcatc gccagtcact

     1081 atggcgtgct gctagcgcca ttcgccattc aggctgcgca actgttggga agggcgatcg

     1141 gtgcgggcct cttcgctatt acgccagctg gcgaaagggg gatgtgctgc aaggcgatta

     1201 agttgggtaa cgccagggtt ttcccagtca cgacgttgta aaacgacggc cagtgaattc

     1261 gagctcaggc cttaactcac attaattgcg ttgcgctcac tgcccgcttt ccagtcggga

     1321 aacctgtcgt gccagctgca ttaatgaatc ggccaacgcg cggggagagg cggtttgcgt

     1381 attgggcgcc agggtggttt ttcttttcac cagtgagacg ggcaacagct gattgccctt

     1441 caccgcctgg ccctgagaga gttgcagcaa gcggtccacg ctggtttgcc ccagcaggcg

     1501 aaaatcctgt ttgatggtgg ttgacggcgg gatataacat gagctgtctt cggtatcgtc

     1561 gtatcccact accgagatat ccgcaccaac gcgcagcccg gactcggtaa tggcgcgcat

     1621 tgcgcccagc gccatctgat cgttggcaac cagcatcgca gtgggaacga tgccctcatt

     1681 cagcatttgc atggtttgtt gaaaaccgga catggcactc cagtcgcctt cccgttccgc

     1741 tatcggctga atttgattgc gagtgagata tttatgccag ccagccagac gcagacgcgc

     1801 cgagacagaa cttaatgggc ccgctaacag cgcgatttgc tggtgaccca atgcgaccag

     1861 atgctccacg cccagtcgcg taccgtcttc atgggagaaa ataatactgt tgatgggtgt

     1921 ctggtcagag acatcaagaa ataacgccgg aacattagtg caggcagctt ccacagcaat

     1981 ggcatcctgg tcatccagcg gatagttaat gatcagccca ctgacgcgtt gcgcgagaag

     2041 attgtgcacc gccgctttac aggcttcgac gccgcttcgt tctaccatcg acaccaccac

     2101 gctggcaccc agttgatcgg cgcgagattt aatcgccgcg acaatttgcg acggcgcgtg

     2161 cagggccaga ctggaggtgg caacgccaat cagcaacgac tgtttgcccg ccagttgttg

     2221 tgccacgcgg ttgggaatgt aattcagctc cgccatcgcc gcttccactt tttcccgcgt

     2281 tttcgcagaa acgtggctgg cctggttcac cacgcgggaa acggtctgat aagagacacc

     2341 ggcatactct gcgacatcgt ataacgttac tggtttcatc aaaatcgtct ccctccgttt

     2401 gaatatttga ttgatcgtaa ccagatgaag cactctttcc actatcccta cagtgttatg

     2461 gcttgaacaa tcacgaaaca ataattggta cgtacgatct ttcagccgac tcaaacatca

     2521 aatcttacaa atgtagtctt tgaaagtatt acatatgtaa gatttaaatg caaccgtttt

     2581 ttcggaagga aatgatgacc tcgtttccac cggaattagc ttggtaccag ctattgtaac

     2641 ataatcggta cgggggtgaa aaagctaacg gaaaagggag cggaaaagaa tgatgtaagc

     2701 gtgaaaaatt ttttatctta tcacttgaaa ttggaaggga gattctttat tataagaatt

     2761 gtggaattgt gagcggataa caattcccaa ttaaaggagg aaggatcaat gattcaaaaa

     2821 cgaaagcgga cagtttcgtt cagacttgtg cttatgtgca cgctgttatt tgtcagtttg

     2881 ccgattacaa aaacatcagc cgtaggatcc tctagagtcg acgtccccgg ggcagcccgc

     2941 ctaatgagcg ggcttttttc acgtcacgcg tccatggaga tctttgtctg caactgaaaa

     3001 gtttatacct tacctggaac aaatggttga aacatacgag gctaatatcg gcttattagg

     3061 aatagtccct gtactaataa aatcaggtgg atcagttgat cagtatattt tggacgaagc

     3121 tcggaaagaa tttggagatg acttgcttaa ttccacaatt aaattaaggg aaagaataaa

     3181 gcgatttgat gttcaaggaa tcacggaaga agatactcat gataaagaag ctctaaaact

     3241 attcaataac cttacaatgg aattgatcga aagggtggaa ggttaatggt acgaaaatta

     3301 ggggatctac ctagaaagcc acaaggcgat aggtcaagct taaagaaccc ttacatggat

     3361 cttacagatt ctgaaagtaa agaaacaaca gaggttaaac aaacagaacc aaaaagaaaa

     3421 aaagcattgt tgaaaacaat gaaagttgat gtttcaatcc ataataagat taaatcgctg

     3481 cacgaaattc tggcagcatc cgaagggaat tcatattact tagaggatac tattgagaga

     3541 gctattgata agatggttga gacattacct gagagccaaa aaacttttta tgaatatgaa

     3601 ttaaaaaaaa gaaccaacaa aggctgagac agactccaaa cgagtctgtt tttttaaaaa

     3661 aaatattagg agcattgaat atatattaga gaattaagaa agacatggga ataaaaatat

     3721 tttaaatcca gtaaaaatat gataagatta tttcagaata tgaagaactc tgtttgtttt

     3781 tgatgaaaaa acaaacaaaa aaaatccacc taacggaatc tcaatttaac taacagcggc

     3841 caaactgaga agttaaattt gagaagggga aaaggcggat ttatacttgt atttaactat

     3901 ctccatttta acattttatt aaaccccata caagtgaaaa tcctctttta cactgttcct

     3961 ttaggtgatc gcggagggac attatgagtg aagtaaacct aaaaggaaat acagatgaat

     4021 tagtgtatta tcgacagcaa accactggaa ataaaatcgc caggaagaga atcaaaaaag

     4081 ggaaagaaga agtttattat gttgctgaaa cggaagagaa gatatggaca gaagagcaaa

     4141 taaaaaactt ttctttagac aaatttggta cgcatatacc ttacatagaa ggtcattata

     4201 caatcttaaa taattacttc tttgattttt ggggctattt tttaggtgct gaaggaattg

     4261 cgctctatgc tcacctaact cgttatgcat acggcagcaa agacttttgc tttcctagtc

     4321 tacaaacaat cgctaaaaaa atggacaaga ctcctgttac agttagaggc tacttgaaac

     4381 tgcttgaaag gtacggtttt atttggaagg taaacgtccg taataaaacc aaggataaca

     4441 cagaggaatc cccgattttt aagattagac gtaaggttcc tttgctttca gaagaacttt

     4501 taaatggaaa ccctaatatt gaaattccag atgacgagga agcacatgta aagaaggctt

     4561 taaaaaagga aaaagagggt cttccaaagg ttttgaaaaa agagcacgat gaatttgtta

     4621 aaaaaatgat ggatgagtca gaaacaatta atattccaga ggccttacaa tatgacacaa

     4681 tgtatgaaga tatactcagt aaaggagaaa ttcgaaaaga aatcaaaaaa caaataccta

     4741 atcctacaac atcttttgag agtatatcaa tgacaactga agaggaaaaa gtcgacagta

     4801 ctttaaaaag cgaaatgcaa aatcgtgtct ctaagccttc ttttgatacc tggtttaaaa

     4861 acactaagat caaaattgaa aataaaaatt gtttattact tgtaccgagt gaatttgcat

     4921 ttgaatggat taagaaaaga tatttagaaa caattaaaac agtccttgaa gaagctggat

     4981 atgttttcga aaaaatcgaa ctaagaaaag tgcaataaac tgctgaagta tttcagcagt

     5041 tttttttatt tagaaatagt gaaaaaaata taatcaggga ggtatcaata tttaatgagt

     5101 actgatttaa atttatttag actggaatta ataattaaca cgtagactaa ttaaaattta

     5161 atgagggata aagaggatac aaaaatatta atttcaatcc ctattaaatt ttaacaaggg

     5221 ggggattaaa atttaattag aggtttatcc acaagaaaag accctaataa aatttttact

     5281 agggttataa cactgattaa tttcttaatg ggggagggat taaaatttaa tgacaaagaa

     5341 aacaatcttt taagaaaagc ttttaaaaga taataataaa aagagctttg cgattaagca

     5401 aaactcttta ctttttcatt gacattatca aattcatcga tttcaaattg ttgttgtatc

     5461 ataaagttaa ttctgttttg cacaaccttt tcaggaatat aaaacacatc tgaggcttgt

     5521 tttataaact cagggtcgct aaagtcaatg taacgtagca tatgatatgg tatagcttcc

     5581 acccaagtta gcctttctgc ttcttctgaa tgtttttcat atacttccat gggtatctct

     5641 aaatgatttt cctcatgtag caaggtatga gcaaaaagtt tatggaattg atagttcctc

     5701 tctttttctt caactttttt atctaaaaca aacactttaa catctgagtc aatgtaagca

     5761 taagatgttt ttccagtcat aatttcaatc ccaaatcttt tagacagaaa ttctggacgt

     5821 aaatcttttg gtgaaagaat ttttttatgt agcaatatat ccgatacagc accttctaaa

     5881 agcgttggtg aatagggcat tttacctatc tcctctcatt ttgtggaata aaaatagtca

     5941 tattcgtcca tctacctatc ctattatcga acagttgaac tttttaatca aggatcagtc

     6001 ctttttttca ttattcttaa actgtgctct taactttaac aactcgattt gtttttccag

     6061 atctcgaggg taactagcct cgccgatccc gcaagaggcc cggcagtcag gtggcacttt

     6121 tcggggaaat gtgcgcggaa cccctatttg tttatttttc taaatacatt caaatatgta

     6181 tccgctcatg agacaataac cctgataaat gcttcaataa tattgaaaaa ggaagagtat

     6241 gagtattcaa catttccgtg tcgcccttat tccctttttt gcggcatttt gccttcctgt

     6301 ttttgctcac ccagaaacgc tggtgaaagt aaaagatgct gaagatcagt tgggtgcacg

     6361 agtgggttac atcgaactgg atctcaacag cggtaagatc cttgagagtt ttcgccccga

     6421 agaacgtttt ccaatgatga gcacttttaa agttctgcta tgtggcgcgg tattatcccg

     6481 tattgacgcc gggcaagagc aactcggtcg ccgcatacac tattctcaga atgacttggt

     6541 tgagtactca ccagtcacag aaaagcatct tacggatggc atgacagtaa gagaattatg

     6601 cagtgctgcc ataaccatga gtgataacac tgcggccaac ttacttctga caacgatcgg

     6661 aggaccgaag gagctaaccg cttttttgca caacatgggg gatcatgtaa ctcgccttga

     6721 tcgttgggaa ccggagctga atgaagccat accaaacgac gagcgtgaca ccacgatgcc

     6781 tgtagcaatg gcaacaacgt tgcgcaaact attaactggc gaactactta ctctagcttc

     6841 ccggcaacaa ttaatagact ggatggaggc ggataaagtt gcaggaccac ttctgcgctc

     6901 ggcccttccg gctggctggt ttattgctga taaatctgga gccggtgagc gtgggtctcg

     6961 cggtatcatt gcagcactgg ggccagatgg taagccctcc cgtatcgtag ttatctacac

     7021 gacggggagt caggcaacta tggatgaacg aaatagacag atcgctgaga taggtgcctc

     7081 actgattaag cattggtaac tgtcagacca agtttactca tatatacttt agattgattt

     7141 aaaacttcat ttttaattta aaaggatcta ggtgaagatc ctttttgata atctcatgac

     7201 caaaatccct taacgtgagt tttcgttcca ctgagcgtca gaccccgtag aaaagatcaa

     7261 aggatcttct tgagatcctt tttttctgcg cgtaatctgc tgcttgcaaa caaaaaaacc

     7321 accgctacca gcggtggttt gtttgccgga tcaagagcta ccaactcttt ttccgaaggt

     7381 aactggcttc agcagagcgc agataccaaa tactgtcctt ctagtgtagc cgtagttagg

     7441 ccaccacttc aagaactctg tagcaccgcc tacatacctc gctctgctaa tcctgttacc

     7501 agtggctgct gccagtggcg ataagtcgtg tcttaccggg ttggactcaa gacgatagtt

     7561 accggataag gcgcagcggt cgggctgaac ggggggttcg tgcacacagc ccagcttgga

     7621 gcgaacgacc tacaccgaac tgagatacct acagcgtgag ctatgagaaa gcgccacgct

     7681 tcccgaaggg agaaaggcgg acaggtatcc ggtaagcggc agggtcggaa caggagagcg

     7741 cacgagggag cttccagggg gaaacgcctg gtatctttat agtcctgtcg ggtttcgcca

     7801 cctctgactt gagcgtcgat ttttgtgatg ctcgtcaggg gggcggagcc tatggaaaaa

     7861 cgccagcaac gcggcctttt tacggttcct ggccttttgc tggccttttg ctcacatgtt

     7921 ctttcctgcg ttatcccctg attctgtgga taaccgtatt accgcctttg agtgagctga

     7981 taccgctcgc cgcagccgaa cgaccgagcg cagcgagtca gtgagcgagg aagcggaaga

     8041 gcgcccaata cgcatgc

//

 

Caution:

1.    This product is FOR RESEARCH USE ONLY!

 

Search name

pHT43,Plasmid pHT43,pHT43 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart