pHY- P43

$260.00

  • Model: PVT11295
  • 50 Units in Stock
Ask a question


Add to Cart:

pHY-P43

Catalog No. PVT11295
Packing 2ug

 

pHY-P43 Information

Promoter: P43 promoter

Replicator: p15A ori, repB

Plasmid size: 5166bp

Prokaryotic resistance: ampicillin Amp

Cloned strain: Escherichia coli DH5 alpha

Culture conditions: 37 centigrade, aerobic, LB

Expression host: Bacillus subtilis

 

pHY-P43 Description

pHY-P43 is the expression plasmid of Bacillus subtilis, and the P43 promoter drives the expression of the target gene.

pHY-P43

 

pHY-P43 Sequence

LOCUS       Exported                5166 bp ds-DNA     circular SYN 22-OCT-2017

DEFINITION  synthetic circular DNA

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5166)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..5166

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    7..286

                     /label=P43 promoter

     misc_feature    290..299

                     /label=RBS

     misc_feature    307..338

                     /label=MCS

     CDS             complement(396..1772)

                     /codon_start=1

                     /gene="Bacillus subtilis tetL"

                     /product="tetracycline efflux protein"

                     /label=TcR

                     /note="confers resistance to tetracycline"

                     /translation="MNTSYSQSNLRHNQILIWLCILSFFSVLNEMVLNVSLPDIANDFN

                     KPPASTNWVNTAFMLTFSIGTAVYGKLSDQLGIKRLLLFGIIINCFGSVIGFVGHSFFS

                     LLIMARFIQGAGAAAFPALVMVVVARYIPKENRGKAFGLIGSIVAMGEGVGPAIGGMIA

                     HYIHWSYLLLIPMITIITVPFLMKLLKKEVRIKGHFDIKGIILMSVGIVFFMLFTTSYS

                     ISFLIVSVLSFLIFVKHIRKVTDPFVDPGLGKNIPFMIGVLCGGIIFGTVAGFVSMVPY

                     MMKDVHQLSTAEIGSVIIFPGTMSVIIFGYIGGILVDRRGPLYVLNIGVTFLSVSFLTA

                     SFLLETTSWFMTIIIVFVLGGLSFTKTVISTIVSSSLKQQEAGAGMSLLNFTSFLSEGT

                     GIAIVGGLLSIPLLDQRLLPMEVDQSTYLYSNLLLLFSGIIVISWLVTLNVYKHSQRDF

                     "

     CDS             complement(1979..2983)

                     /codon_start=1

                     /gene="repB"

                     /product="RepB replication protein"

                     /label=repB

                     /note="from Enterococcus faecalis plasmid pAM-alpha-1"

                     /db_xref="GI:22652809"

                     /protein_id="AAN03827.1"

                     /translation="MGVSFNIMCPNSSIYSDEKSRVLVDKTKSGKVRPWREKKIANVDY

                     FELLHILEFKKAERVKDCAEILEYKQNRETGERKLYRVWFCKSRLCPMCNWRRAMKHGI

                     QSQKVVAEVIKQKPTVRWLFLTLTVKNVYDGEELNKSLSDMAQGFRRMMQYKKINKNLV

                     GFMRATEVTINNKDNSYNQHMHVLVCVEPTYFKNTENYVNQKQWIQFWKKAMKLDYDPN

                     VKVQMIRPKNKYKSDIQSAIDETAKYPVKDTDFMTDDEEKNLKRLSDLEEGLHRKRLIS

                     YGGLLKEIHKKLNLDDTEEGDLIHTDDDEKADEDGFSIIAMWNWERKNYFIKE"

     promoter        3480..3584

                     /gene="bla"

                     /label=AmpR promoter

     CDS             3585..4445

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=AmpR

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     rep_origin      4610..5154

                     /direction=RIGHT

                     /label=p15A ori

                     /note="Plasmids containing the medium-copy-number p15A 

                     origin of replication can be propagated in E. coli cells 

                     that contain a second plasmid with the ColE1 origin."

ORIGIN

        1 aagctttgat aggtggtatg ttttcgcttg aacttttaaa tacagccatt gaacatacgg

       61 ttgatttaat aactgacaaa catcaccctc ttgctaaagc ggccaaggac gctgccgccg

      121 gggctgtttg cgtttttgcc gtgatttcgt gtatcattgg tttacttatt tttttgccaa

      181 agctgtaatg gctgaaaatt cttacattta ttttacattt ttagaaatgg gcgtgaaaaa

      241 aagcgcgcga ttatgtaaaa tataaagtga tagcggtacc attataggta agagaggaac

      301 gtacacagat ctgcaggtcg acggatcccc gggaattcct gttataaaaa aaggatcaat

      361 tttgaactct ctcccaaagt tgatccctta acgatttaga aatccctttg agaatgttta

      421 tatacattca aggtaaccag ccaactaatg acaatgattc ctgaaaaaag taataacaaa

      481 ttactataca gataagttga ctgatcaact tccataggta acaacctttg atcaagtaag

      541 ggtatggata ataaaccacc tacaattgca atacctgttc cctctgataa aaagctggta

      601 aagttaagca aactcattcc agcaccagct tcctgctgtt tcaagctact tgaaacaatt

      661 gttgatataa ctgttttggt gaacgaaagc ccacctaaaa caaatacgat tataattgtc

      721 atgaaccatg atgttgtttc taaaagaaag gaagcagtta aaaagctaac agaaagaaat

      781 gtaactccga tgtttaacac gtataaagga cctcttctat caacaagtat cccaccaatg

      841 tagccgaaaa taatgacact cattgttcca gggaaaataa ttacacttcc gatttcggca

      901 gtacttagct ggtgaacatc tttcatcata taaggaacca tagagacaaa ccctgctact

      961 gttccaaata taattccccc acaaagaact ccaatcataa aaggtatatt tttccctaat

     1021 ccgggatcaa caaaaggatc tgttactttc ctgatatgtt ttacaaatat caggaatgac

     1081 agcacgctaa cgataagaaa agaaatgcta tatgatgttg taaacaacat aaaaaataca

     1141 atgcctacag acattagtat aattcctttg atatcaaaat gaccttttat ccttacttct

     1201 ttctttaata atttcataag aaacggaaca gtgataattg ttatcatagg aatgagtaga

     1261 agataggacc aatgaatata atgggctatc attccaccaa tcgctggacc gactccttct

     1321 cccatggcta ctatcgatcc aataagacca aatgctttac ccctattttc ctttggaata

     1381 tagcgcgcaa ctacaaccat tacgagtgct ggaaatgcag ctgcaccagc cccttgaata

     1441 aaacgagcca taataagtaa ggaaaagaaa gaatggccaa caaacccaat taccgacccg

     1501 aaacaattta ttataattcc aaataggagt aaccttttga tgcctaattg atcagatagc

     1561 tttccatata cagctgttcc aatggaaaag gttaacataa aggctgtgtt cacccagttt

     1621 gtactcgcag gtggtttatt aaaatcattt gcaatatcag gtaatgagac gttcaaaacc

     1681 atttcattta atacgctaaa aaaagataaa atgcaaagcc aaattaaaat ttggttgtgt

     1741 cgtaaattcg attgtgaata ggatgtattc acatttcacc ctccaataat gagggcagac

     1801 gtagtttata gggttaatga tacgcttccc tcttttaatt gaaccctgtt acattcatta

     1861 ttcattacac ttcataatta attcctccta aacttgatta aaacatttta ccacatataa

     1921 actaagtttt aaattcagta tttcatcact tatacaacaa tatggcccgt ttgttgaact

     1981 actctttaat aaaataattt ttccgttccc aattccacat tgcaataata gaaaatccat

     2041 cttcatcggc tttttcgtca tcatctgtat gaatcaaatc gccttcttct gtgtcatcaa

     2101 ggtttaattt tttatgtatt tcttttaaca aaccaccata ggagattaac cttttacggt

     2161 gtaaaccttc ctccaaatca gacaaacgtt tcaaattctt ttcttcatca tcggtcataa

     2221 aatccgtatc ctttacagga tattttgcag tttcgtcaat tgccgattgt atatccgatt

     2281 tatatttatt tttcggtcga atcatttgaa cttttacatt tggatcatag tctaatttca

     2341 ttgccttttt ccaaaattga atccattgtt tttgattcac gtagttttct gtattcttaa

     2401 aataagttgg ttccacacat accaatacat gcatgtgctg attataagaa ttatctttat

     2461 tatttattgt cacttccgtt gcacgcataa aaccaacaag atttttatta atttttttat

     2521 attgcatcat tcggcgaaat ccttgagcca tatctgacaa actcttattt aattcttcgc

     2581 catcataaac atttttaact gttaatgtga gaaacaacca acgaactgtt ggcttttgtt

     2641 taataacttc agcaacaacc ttttgtgact gaatgccatg tttcattgct ctcctccagt

     2701 tgcacattgg acaaagcctg gatttacaaa accacactcg atacaacttt ctttcgcctg

     2761 tttcacgatt ttgtttatac tctaatattt cagcacaatc ttttactctt tcagcctttt

     2821 taaattcaag aatatgcaga agttcaaagt aatcaacatt agcgattttc ttttctctcc

     2881 atggtctcac ttttccactt tttgtcttgt ccactaaaac ccttgatttt tcatctgaat

     2941 aaatgctact attaggacac ataatattaa aagaaacccc catctattta gttatttgtt

     3001 tggtcactta taactttaac agatggggtt tttctgtgca accaatttta agggttttcc

     3061 aatactttaa aacacataca taccaacact tcaacgcacc tttcagcaac taaaataaaa

     3121 atgacgttat ttctatatgt atcaagataa gaaagaacaa gttcaaaacc atcaaaaaaa

     3181 gacacctttt caggtgcttt ttttatttta taaactcatt ccctgatctc gacttcgttc

     3241 tttttttacc tctcggttat gagttagttc aaattcgttc tttttaggtt ctaaatcgtg

     3301 tttttcttgg aattgtgctg ttttatcctt taccttgtct acaaacccct taaaaacgtt

     3361 tttaaaggct tttaagcgtc tgtacgttcc ttaaggaatt attccttagt gctttctagg

     3421 ttaatgtcat gataataatg gtttcttaga cgtcaggtgg cacttttcgg ggaaatgtcc

     3481 gcggaacccc tatttgttta tttttctaaa tacattcaaa tatgtatccg ctcatgagac

     3541 aataaccctg ataaatgctt caataatatt gaaaaaggaa gagtatgagt attcaacatt

     3601 tccgtgtcgc ccttattccc ttttttgcgg cattttgcct tcctgttttt gctcacccag

     3661 aaacgctggt gaaagtaaaa gatgctgaag atcagttggg tgcacgagtg ggttacatcg

     3721 aactggatct caacagcggt aagatccttg agagttttcg ccccgaagaa cgttttccaa

     3781 tgatgagcac ttttaaagtt ctgctatgtg gcgcggtatt atcccgtgtt gacgccgggc

     3841 aagagcaact cggtcgccgc atacactatt ctcagaatga cttggttgag tactcaccag

     3901 tcacagaaaa gcatcttacg gatggcatga cagtaagaga attatgcagt gctgccataa

     3961 ccatgagtga taacactgcg gccaacttac ttctgacaac gatcggagga ccgaaggagc

     4021 taaccgcttt tttgcacaac atgggggatc atgtaactcg ccttgatcgt tgggaaccgg

     4081 agctgaatga agccatacca aacgacgagc gtgacaccac gatgcctgca gcaatggcaa

     4141 caacgttgcg caaactatta actggcgaac tacttactct agcttcccgg caacaattaa

     4201 tagactggat ggaggcggat aaagttgcag gaccacttct gcgctcggcc cttccggctg

     4261 gctggtttat tgctgataaa tctggagccg gtgagcgtgg gtctcgcggt atcattgcag

     4321 cactggggcc agatggtaag ccctcccgta tcgtagttat ctacacgacg gggagtcagg

     4381 caactatgga tgaacgaaat agacagatcg ctgagatagg tgcctcactg attaagcatt

     4441 ggtaactgtc agaccaagtt tactcatata tactttagat tgatttaaaa cttcattttt

     4501 aatttaaaag gatctaggtg aagatccttt ttgataatct catgaccaaa atcccttaac

     4561 gtgagttttc gttccactga gcgtcagacc ccttaataag atgatcttct tgagatcgtt

     4621 ttggtctgcg cgtaatctct tgctctgaaa acgaaaaaac cgccttgcag ggaggttttt

     4681 cgaaggttct ctgagctacc aactctttga accgaggtaa ctggcttgca ggagcgcagt

     4741 caccaaaact tgtcctttca gtttagcctt aaccggcgca tgacttcaag actaactcct

     4801 ctaaatcaat taccagtggc tgctgccagt ggtgcttttg catgtctttc cgggttggac

     4861 tcaagacgat agttaccgga taaggcgcag cggtcggact gaacgggggg ttcgtgcata

     4921 cagtccagct tggagcgaac tgcctacccg gaactgagtg tcaggcgtgg aatgagacaa

     4981 acgcggccat aacagcggaa tgacaccggt aaaccgaaag gcaggaacag gagagcgcac

     5041 gagggagccg ccagggggaa acgcctggta tctttatagt cctgtcgggt ttcgccacca

     5101 ctgatttgag cgtcagattt cgtgatgctt gtcagggggc ggagcctatg gaaaaacgct

     5161 ttgccc

//

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart