pInt

$193.00

  • Model: PVT10521
  • 50 Units in Stock
Ask a question


Add to Cart:

pInt


Catalog No. PVT10521
Packing 2ug
 

pInt Information

Promoter: Lac promoter, T3 promoter

Replicon: p15A ori

Plasmid classification: gene library plasmid; other gene plasmids; other source plasmids.

Plasmid size: 5198bp

Prokaryotic resistance: kanamycin Kan (50 g/ml)

Cloning strains: E. coli DH5 and E.

Culture conditions: 37 C, aerobic, LB

Remarks: low copy

 

pInt Description

PInt provides Streptomyces phage phiC31 gene.

 

pInt  Reference

A phage integrase directs efficient site-specific integration in human cells.

 

pInt Sequence

LOCUS       Exported                5198 bp ds-DNA     circular SYN 15-AUG-2017
KEYWORDS    pInt.dna
FEATURES             Location/Qualifiers
     source          1..5198
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     CDS             complement(16..1833)
                     /codon_start=1
                     /product="integrase from phage phi-C31"
                     /label=phage phi-C31 integrase
                     /translation="MDTYAGAYDRQSRERENSSAASPATQRSANEDKAADLQREVERDG
                     GRFRFVGHFSEAPGTSAFGTAERPEFERILNECRAGRLNMIIVYDVSRFSRLKVMDAIP
                     IVSELLALGVTIVSTQEGVFRQGNVMDLIHLIMRLDASHKESSLKSAKILDTKNLQREL
                     GGYVGGKAPYGFELVSETKEITRNGRMVNVVINKLAHSTTPLTGPFEFEPDVIRWWWRE
                     IKTHKHLPFKPGSQAAIHPGSITGLCKRMDADAVPTRGETIGKKTASSAWDPATVMRIL
                     RDPRIAGFAAEVIYKKKPDGTPTTKIEGYRIQRDPITLRPVELDCGPIIEPAEWYELQA
                     WLDGRGRGKGLSRGQAILSAMDKLYCECGAVMTSKRGEESIKDSYRCRRRKVVDPSAPG
                     QHEGTCNVSMAALDKFVAERIFNKIRHAEGDEETLALLWEAARRFGKLTEAPEKSGERA
                     NLVAERADALNALEELYEDRAAGAYDGPVGRKHFRKQQAALTLRQQGAEERLAELEAAE
                     APKLPLDQWFPEDADADPTGPKSWWGRASVDDKRVFVGLFVDKIVVTKSTTGRGQGTPI
                     EKRASITWAKPPTDDDEDDAQDGTEDVAA"
     promoter        complement(1897..1915)
                     /label=T3 promoter
                     /note="promoter for bacteriophage T3 RNA polymerase"
     primer_bind     complement(1936..1952)
                     /label=M13 rev
                     /note="common sequencing primer, one of multiple similar 
                     variants"
     protein_bind    1960..1976
                     /label=lac operator
                     /bound_moiety="lac repressor encoded by lacI"
                     /note="The lac repressor binds to the lac operator to 
                     inhibit transcription in E. coli. This inhibition can be 
                     relieved by adding lactose or 
                     isopropyl-beta-D-thiogalactopyranoside (IPTG)."
     promoter        complement(1984..2014)
                     /label=lac promoter
                     /note="promoter for the E. coli lac operon"
     protein_bind    2029..2050
                     /label=CAP binding site
                     /bound_moiety="E. coli catabolite activator protein"
                     /note="CAP binding activates transcription in the presence 
                     of cAMP."
     rep_origin      2662..3206
                     /direction=RIGHT
                     /label=p15A ori
                     /note="Plasmids containing the medium-copy-number p15A 
                     origin of replication can be propagated in E. coli cells 
                     that contain a second plasmid with the ColE1 origin."
     CDS             3801..4616
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPDAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHKLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
ORIGIN
        1 gatccgggtg tctcgctacg ccgctacgtc ttccgtgccg tcctgggcgt cgtcttcgtc
       61 gtcgtcggtc ggcggcttcg cccacgtgat cgaagcgcgc ttctcgatgg gcgttccctg
      121 ccccctgccc gtagtcgact tcgtgacaac gatcttgtct acgaagagcc cgacgaacac
      181 gcgcttgtcg tctactgacg cgcgccccca ccacgactta gggccggtcg ggtcagcgtc
      241 ggcgtcttcg gggaaccatt ggtcaagggg aagcttcggg gcttcggcgg cttcaagttc
      301 ggcaagccgc tcttccgccc cttgctgccg gagcgtcagc gctgcctgtt gcttccggaa
      361 gtgcttcctg ccaacgggtc cgtcgtacgc gcctgccgcg cggtcttcgt acagctcttc
      421 aagggcgttc agggcgtcgg cgcgctccgc aacaaggttc gcccgttcgc cgctcttctc
      481 aggcgcctca gtgagcttgc cgaagcgtcg ggcggcttcc cacagaagcg ccaacgtctc
      541 ttcgtcgcct tcggcgtgcc tgatcttgtt gaagatgcgt tccgcaacga acttgtcgag
      601 tgccgccatg ctgacgttgc acgtgccttc gtgctgccca ggtgcggacg ggtcgaccac
      661 cttccggcga cggcagcggt aagagtcctt gatcgattct tccccgcgct tcgaagtcat
      721 gacggcgcca cactcgcagt acagcttgtc catggcggac agaatggctt gcccccggga
      781 aagccccttg ccgcgccccc tgccgtccaa ccacgcctga agctcatacc actcagcggg
      841 ctcgatgatc ggtccgcaat caagctcgac cggccggagc gtgatcgggt cgcgctgaat
      901 gcggtaaccc tcaatcttcg tggtcggcgt gccgtccggc ttcttcttgt agatcacctc
      961 agcggcgaag cccgcaatac gcgggtcccg aaggattcgc ataacggttg ccgggtccca
     1021 ggcgcttgaa gcggtcttct tcccaatcgt ctcgccccgg gtcggcacgg cgtcagcgtc
     1081 catgcgctta caaagccccg tgatgctgcc cgggtgaatg gcggcttgac tgcccggctt
     1141 gaagggaagg tgtttgtgcg tcttgatctc acgccaccac caccggatta cgtcgggctc
     1201 gaactcgaag ggtccggtaa ggggagtggt cgagtgcgca agcttgttga tgacgacatt
     1261 gaccattcgg ccgttgcgcg tgatctcctt cgtctccgaa acaagctcga agccgtaagg
     1321 cgccttcccg ccgacgtacc cgcccaattc gcgctgaagg ttcttcgtgt cgagaatctt
     1381 cgccgacttc agcgaagatt ctttgtgcga cgcgtcgagc cgcataatca ggtgaatcag
     1441 gtccatgacg tttccctgcc ggaagacgcc ttcctgagtg gaaacaatcg tcacgcccag
     1501 ggcgagcaat tccgagacaa tcggaatcgc gtccatgacc ttcaggcgcg agaagcgcga
     1561 cacgtcatag acaatgatca tgttgagccg cccggcgcgg cattcgttca ggatgcgttc
     1621 gaactccggg cgctccgccg tcccgaacgc cgacgtgccc ggcgcttcgc tgaaatgccc
     1681 gacgaacctg aaccggcccc cgtcgcgctc gacttcgcgc tgaaggtcgg ccgccttgtc
     1741 ttcgttggcg ctacgctgtg tcgctgggct tgctgcgctc gaattctcgc gctcgcgcga
     1801 ctgacggtcg taagcacccg cgtacgtgtc caccccggtc acaacccctt gtgtcatgtc
     1861 ggcgacccta cgactagtga gctccagctt ttgttccctt tagtgagggt taattgcgcg
     1921 cttggcgtaa tcatggtcat agctgtttcc tgtgtgaaat tgttatccgc tcacaattcc
     1981 acacaacata cgagccggaa gcataaagtg taaagcctgg ggtgcctaat gagtgagcta
     2041 actcacatta attgcgttgc gctcactgcc cgctttccag tcgggaaacc tgtcgtgcca
     2101 gctgcattaa tgaatcggcc aacgcgcggg gagaggcggt ttgcgtattg ggcgctcttc
     2161 cgctcggcca aaaaggcctg cagcaatggc aacaacgttg cgcaaactat taactggcga
     2221 actacttact ctagcttccc ggcaacaatt aatagactgg atggaggcgg ataaagttgc
     2281 aggaccactt ctgcgctcgg cccttccggc tggctggttt attgctgata aatctggagc
     2341 cggtgagcgt gggtctcgcg gtatcattgc agcactgggg ccagatggta agccctcccg
     2401 tatcgtagtt atctacacga cggggagtca ggcaactatg gatgaacgaa atagacagat
     2461 cgctgagata ggtgcctcac tgattaagca ttggtaactg tcagaccaag tttactcata
     2521 tatactttag attgatttaa aacttca
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart