pIRES2- DsRed2

$193.00

  • Model: PVT10757
  • 50 Units in Stock
Ask a question


Add to Cart:

pIRES2-DsRed2

Catalog No. PVT10757
Packing 2ug

 

pIRES2-DsRed2 Information
Function Mammalian fluorescent plasmidPromoter: CMV promoter
Terminator: SV40 poly A
Plasmid size: 5264bp
Prokaryotic resistance: Kanamycin Kan
Filtering Mark: Neomycin Neo/G418
Cloning strain: E. coli DH5α
Culture conditions: 37°C, aerobic, LB

 

pIRES2-DsRed2 Description

pIRES2-DsRed2 is a mammalian red fluorescent protein overexpression vector. Through the action of IRES2, the target gene and DsRed2 red fluorescent protein are translated under the same promoter, but no fusion protein is formed.

 

pIRES2-DsRed2 Sequence

LOCUS       Exported                5264 bp ds-DNA    circular SYN 22-10-2015

KEYWORDS    Untitled 2

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 5264)

  AUTHORS   admin

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..5264

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     enhancer        61..364

                     /note="CMV enhancer"

                     /note="human cytomegalovirus immediate early enhancer"

     promoter        365..568

                     /note="CMV promoter"

                     /note="human cytomegalovirus (CMV) immediate early 

                     promoter"

     misc_feature    609..665

                     /note="MCS"

                     /note="multiple cloning site"

     misc_feature    667..1253

                     /note="IRES2"

                     /note="internal ribosome entry site (IRES) of the 

                     encephalomyocarditis virus (EMCV)"

     CDS             1254..1931

                     /codon_start=1

                     /product="improved tetrameric variant of DsRed fluorescent 

                     protein"

                     /note="DsRed2"

                     /note="mammalian codon-optimized"

                     /translation="MASSENVITEFMRFKVRMEGTVNGHEFEIEGEGEGRPYEGHNTVK

                     LKVTKGGPLPFAWDILSPQFQYGSKVYVKHPADIPDYKKLSFPEGFKWERVMNFEDGGV

                     ATVTQDSSLQDGCFIYKVKFIGVNFPSDGPVMQKKTMGWEASTERLYPRDGVLKGETHK

                     ALKLKDGGHYLVEFKSIYMAKKPVQLPGYYYVDAKLDITSHNEDYTIVEQYERTEGRHH

                     LFL"

     polyA_signal    2052..2173

                     /note="SV40 poly(A) signal"

                     /note="SV40 polyadenylation signal"

     rep_origin      complement(2180..2635)

                     /direction=LEFT

                     /note="f1 ori"

                     /note="f1 bacteriophage origin of replication; arrow 

                     indicates direction of (+) strand synthesis"

     promoter        2662..2766

                     /gene="bla"

                     /note="AmpR promoter"

     promoter        2768..3125

                     /note="SV40 promoter"

                     /note="SV40 enhancer and early promoter"

     rep_origin      2976..3111

                     /note="SV40 ori"

                     /note="SV40 origin of replication"

     CDS             3160..3954

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /note="NeoR/KanR"

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKASMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     polyA_signal    4186..4233

                     /note="HSV TK poly(A) signal"

                     /note="herpesvirus thymidine kinase polyadenylation signal"

     rep_origin      4562..5150

                     /direction=RIGHT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 tagttattaa tagtaatcaa ttacggggtc attagttcat agcccatata tggagttccg

       61 cgttacataa cttacggtaa atggcccgcc tggctgaccg cccaacgacc cccgcccatt

      121 gacgtcaata atgacgtatg ttcccatagt aacgccaata gggactttcc attgacgtca

      181 atgggtggag tatttacggt aaactgccca cttggcagta catcaagtgt atcatatgcc

      241 aagtacgccc cctattgacg tcaatgacgg taaatggccc gcctggcatt atgcccagta

      301 catgacctta tgggactttc ctacttggca gtacatctac gtattagtca tcgctattac

      361 catggtgatg cggttttggc agtacatcaa tgggcgtgga tagcggtttg actcacgggg

      421 atttccaagt ctccacccca ttgacgtcaa tgggagtttg ttttggcacc aaaatcaacg

      481 ggactttcca aaatgtcgta acaactccgc cccattgacg caaatgggcg gtaggcgtgt

      541 acggtgggag gtctatataa gcagagctgg tttagtgaac cgtcagatcc gctagcgcta

      601 ccggactcag atctcgagct caagcttcga attctgcagt cgacggtacc gcgggcccgg

      661 gatccgcccc tctccctccc ccccccctaa cgttactggc cgaagccgct tggaataagg

      721 ccggtgtgcg tttgtctata tgttattttc caccatattg ccgtcttttg gcaatgtgag

      781 ggcccggaaa cctggccctg tcttcttgac gagcattcct aggggtcttt cccctctcgc

      841 caaaggaatg caaggtctgt tgaatgtcgt gaaggaagca gttcctctgg aagcttcttg

      901 aagacaaaca acgtctgtag cgaccctttg caggcagcgg aaccccccac ctggcgacag

      961 gtgcctctgc ggccaaaagc cacgtgtata agatacacct gcaaaggcgg cacaacccca

     1021 gtgccacgtt gtgagttgga tagttgtgga aagagtcaaa tggctctcct caagcgtatt

     1081 caacaagggg ctgaaggatg cccagaaggt accccattgt atgggatctg atctggggcc

     1141 tcggtgcaca tgctttacat gtgtttagtc gaggttaaaa aaacgtctag gccccccgaa

     1201 ccacggggac gtggttttcc tttgaaaaac acgatgataa tatggccaca accatggcct

     1261 cctccgagaa cgtcatcacc gagttcatgc gcttcaaggt gcgcatggag ggcaccgtga

     1321 acggccacga gttcgagatc gagggcgagg gcgagggccg cccctacgag ggccacaaca

     1381 ccgtgaagct gaaggtgacc aagggcggcc ccctgccctt cgcctgggac atcctgtccc

     1441 cccagttcca gtacggctcc aaggtgtacg tgaagcaccc cgccgacatc cccgactaca

     1501 agaagctgtc cttccccgag ggcttcaagt gggagcgcgt gatgaacttc gaggacggcg

     1561 gcgtggcgac cgtgacccag gactcctccc tgcaggacgg ctgcttcatc tacaaggtga

     1621 agttcatcgg cgtgaacttc ccctccgacg gccccgtgat gcagaagaag accatgggct

     1681 gggaggcctc caccgagcgc ctgtaccccc gcgacggcgt gctgaagggc gagacccaca

     1741 aggccctgaa gctgaaggac ggcggccact acctggtgga gttcaagtct atctacatgg

     1801 ccaagaagcc cgtgcagctg cccggctact actacgtgga cgccaagctg gacatcacct

     1861 cccacaacga ggactacacc atcgtggagc agtacgagcg caccgagggc cgccaccacc

     1921 tgttcctgta gcggccgcga ctctagatca taatcagcca taccacattt gtagaggttt

     1981 tacttgcttt aaaaaacctc ccacacctcc ccctgaacct gaaacataaa atgaatgcaa

     2041 ttgttgttgt taacttgttt attgcagctt ataatggtta caaataaagc aatagcatca

     2101 caaatttcac aaataaagca tttttttcac tgcattctag ttgtggtttg tccaaactca

     2161 tcaatgtatc ttaaggcgta aattgtaagc gttaatattt tgttaaaatt cgcgttaaat

     2221 ttttgttaaa tcagctcatt ttttaaccaa taggccgaaa tcggcaaaat cccttataaa

     2281 tcaaaagaat agaccgagat agggttgagt gttgttccag tttggaacaa gagtccacta

     2341 ttaaagaacg tggactccaa cgtcaaaggg cgaaaaaccg tctatcaggg cgatggccca

     2401 ctacgtgaac catcacccta atcaagtttt ttggggtcga ggtgccgtaa agcactaaat

     2461 cggaacccta aagggagccc ccgatttaga gcttgacggg gaaagccggc gaacgtggcg

     2521 agaaaggaag ggaagaaagc gaaaggagcg ggcgctaggg cgctggcaag tgtagcggtc

     2581 acgctgcgcg taaccaccac acccgccgcg cttaatgcgc cgctacaggg cgcgtcaggt

     2641 ggcacttttc ggggaaatgt gcgcggaacc cctatttgtt tatttttcta aatacattca

     2701 aatatgtatc cgctcatgag acaataaccc tgataaatgc ttcaataata ttgaaaaagg

     2761 aagagtcctg aggcggaaag aaccagctgt ggaatgtgtg tcagttaggg tgtggaaagt

     2821 ccccaggctc cccagcaggc agaagtatgc aaagcatgca tctcaattag tcagcaacca

     2881 ggtgtggaaa gtccccaggc tccccagcag gcagaagtat gcaaagcatg catctcaatt

     2941 agtcagcaac catagtcccg cccctaactc cgcccatccc gcccctaact ccgcccagtt

     3001 ccgcccattc tccgccccat ggctgactaa ttttttttat ttatgcagag gccgaggccg

     3061 cctcggcctc tgagctattc cagaagtagt gaggaggctt ttttggaggc ctaggctttt

     3121 gcaaagatcg atcaagagac aggatgagga tcgtttcgca tgattgaaca agatggattg

     3181 cacgcaggtt ctccggccgc ttgggtggag aggctattcg gctatgactg ggcacaacag

     3241 acaatcggct gctctgatgc cgccgtgttc cggctgtcag cgcaggggcg cccggttctt

     3301 tttgtcaaga ccgacctgtc cggtgccctg aatgaactgc aagacgaggc agcgcggcta

     3361 tcgtggctgg ccacgacggg cgttccttgc gcagctgtgc tcgacgttgt cactgaagcg

     3421 ggaagggact ggctgctatt gggcgaagtg ccggggcagg atctcctgtc atctcacctt

     3481 gctcctgccg agaaagtatc catcatggct gatgcaatgc ggcggctgca tacgcttgat

     3541 ccggctacct gcccattcga ccaccaagcg aaacatcgca tcgagcgagc acgtactcgg

     3601 atggaagccg gtcttgtcga tcaggatgat ctggacgaag agcatcaggg gctcgcgcca

     3661 gccgaactgt tcgccaggct caaggcgagc atgcccgacg gcgaggatct cgtcgtgacc

     3721 catggcgatg cctgcttgcc gaatatcatg gtggaaaatg gccgcttttc tggattcatc

     3781 gactgtggcc ggctgggtgt ggcggaccgc tatcaggaca tagcgttggc tacccgtgat

     3841 attgctgaag agcttggcgg cgaatgggct gaccgcttcc tcgtgcttta cggtatcgcc

     3901 gctcccgatt cgcagcgcat cgccttctat cgccttcttg acgagttctt ctgagcggga

     3961 ctctggggtt cgaaatgacc gaccaagcga cgcccaacct gccatcacga gatttcgatt

     4021 ccaccgccgc cttctatgaa aggttgggct tcggaatcgt tttccgggac gccggctgga

     4081 tgatcctcca gcgcggggat ctcatgctgg agttcttcgc ccaccctagg gggaggctaa

     4141 ctgaaacacg gaaggagaca ataccggaag gaacccgcgc tatgacggca ataaaaagac

     4201 agaataaaac gcacggtgtt gggtcgtttg ttcataaacg cggggttcgg tcccagggct

     4261 ggcactctgt cgatacccca ccgagacccc attggggcca atacgcccgc gtttcttcct

     4321 tttccccacc ccacccccca agttcgggtg aaggcccagg gctcgcagcc aacgtcgggg

     4381 cggcaggccc tgccatagcc tcaggttact catatatact ttagattgat ttaaaacttc

     4441 atttttaatt taaaaggatc taggtgaaga tcctttttga taatctcatg accaaaatcc

     4501 cttaacgtga gttttcgttc cactgagcgt cagaccccgt agaaaagatc aaaggatctt

     4561 cttgagatcc tttttttctg cgcgtaatct gctgcttgca aacaaaaaaa ccaccgctac

     4621 cagcggtggt ttgtttgccg gatcaagagc taccaactct ttttccgaag gtaactggct

     4681 tcagcagagc gcagatacca aatactgtcc ttctagtgta gccgtagtta ggccaccact

     4741 tcaagaactc tgtagcaccg cctacatacc tcgctctgct aatcctgtta ccagtggctg

     4801 ctgccagtgg cgataagtcg tgtcttaccg ggttggactc aagacgatag ttaccggata

     4861 aggcgcagcg gtcgggctga acggggggtt cgtgcacaca gcccagcttg gagcgaacga

     4921 cctacaccga actgagatac ctacagcgtg agctatgaga aagcgccacg cttcccgaag

     4981 ggagaaaggc ggacaggtat ccggtaagcg gcagggtcgg aacaggagag cgcacgaggg

     5041 agcttccagg gggaaacgcc tggtatcttt atagtcctgt cgggtttcgc cacctctgac

     5101 ttgagcgtcg atttttgtga tgctcgtcag gggggcggag cctatggaaa aacgccagca

     5161 acgcggcctt tttacggttc ctggcctttt gctggccttt tgctcacatg ttctttcctg

     5221 cgttatcccc tgattctgtg gataaccgta ttaccgccat gcat

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart