pIZT/ V5- His Plasmid

$216.00

  • Model: PVT5106
  • 50 Units in Stock
Ask a question


Add to Cart:

pIZT/ V5-His

Search name

pIZT/V5-His,Plasmid pIZT/V5-His,pIZT/V5-His vector

 

pIZT/V5-His Information

Bacterial Resistance:ZeO
Growth Strain:
Expression: Bacterial
Use:Insect cell plasmid

 

pIZT/V5-His Description

pIZT/V5-His expresses a fusion of the green fluorescent protein and the Zeocin™ resistanceprotein (Zeo-GFP). The Zeo-GFP fusion protein permits rapid selection of stably transfected cell lineswith Zeocin™ and confers a fluorescent phenotype that simplifies identification of transfected cells.

pIZT/V5-His-plasmid

 

pIZT/V5-His Sequence

LOCUS       Exported                3336 bp ds-DNA     circular SYN 07-SEP-2016
DEFINITION  synthetic circular DNA
ACCESSION   .
VERSION     .
KEYWORDS    Untitled 12
SOURCE      synthetic DNA construct
  ORGANISM  synthetic DNA construct
REFERENCE   1  (bases 1 to 3336)
  AUTHORS   .
  TITLE     Direct Submission
  JOURNAL   Exported Wednesday, September 7, 2016 from SnapGene Viewer 3.1.4
           
FEATURES             Location/Qualifiers
     source          1..3336
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     promoter        5..552
                     /gene="immediate-early gene 2 from the Orgyia pseudotsugata
                     multicapsid nucleopolyhedrovirus"
                     /note="OpIE-2 promoter"
                     /note="strong constitutive baculovirus promoter for insect 
                     cell expression"
     CDS             663..704
                     /codon_start=1
                     /product="epitope tag from simian virus 5"
                     /note="V5 tag"
                     /translation="GKPIPNPLLGLDST"
     CDS             714..731
                     /codon_start=1
                     /product="6xHis affinity tag"
                     /note="6xHis"
                     /translation="HHHHHH"
     polyA_signal    749..878
                     /gene="immediate-early gene 2 from the Orgyia pseudotsugata
                     multicapsid nucleopolyhedrovirus"
                     /note="OpIE-2 poly(A) signal"
                     /note="baculovirus polyadenylation signal"
     rep_origin      complement(1006..1594)
                     /direction=LEFT
                     /note="ori"
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
     promoter        1669..1960
                     /gene="immediate-early gene 1 from the Orgyia pseudotsugata
                     multicapsid nucleopolyhedrovirus"
                     /note="OpIE-1 promoter"
                     /note="moderate constitutive baculovirus promoter for 
                     insect cell expression"
     promoter        1986..2033
                     /note="EM7 promoter"
                     /note="synthetic bacterial promoter "
     CDS             2766..3143
                     /codon_start=1
                     /gene="Sh ble from Streptoalloteichus hindustanus"
                     /product="antibiotic-binding protein"
                     /note="BleoR"
                     /note="confers resistance to bleomycin, phleomycin, and 
                     Zeocin(TM)"
                     /translation="MDAKLTSAVPVLTARDVAGAVEFWTDRLGFSRDFVEDDFAGVVRD
                     DVTLFISAVQDQVVPDNTLAWVWVRGLDELYAEWSEVVSTNFRDASGPAMTEIGEQPWG
                     REFALRDPAGNCVHFVAEEQD"
     polyA_signal    3207..5
                     /note="SV40 poly(A) signal"
                     /note="SV40 polyadenylation signal"
ORIGIN
        1 ggatcatgat gataaacaat gtatggtgct aatgttgctt caacaacaat tctgttgaac
       61 tgtgttttca tgtttgccaa caagcacctt tatactcggt ggcctcccca ccaccaactt
      121 ttttgcactg caaaaaaaca cgcttttgca cgcgggccca tacatagtac aaactctacg
      181 tttcgtagac tattttacat aaatagtcta caccgttgta tacgctccaa atacactacc
      241 acacattgaa cctttttgca gtgcaaaaaa gtacgtgtcg gcagtcacgt aggccggcct
      301 tatcgggtcg cgtcctgtca cgtacgaatc acattatcgg accggacgag tgttgtctta
      361 tcgtgacagg acgccagctt cctgtgttgc taaccgcagc cggacgcaac tccttatcgg
      421 aacaggacgc gcctccatat cagccgcgcg ttatctcatg cgcgtgaccg gacacgaggc
      481 gcccgtcccg cttatcgcgc ctataaatac agcccgcaac gatctggtaa acacagttga
      541 acagcatctg ttcgaattta aagcttggta ccgagctcgg atccactagt ccagtgtggt
      601 ggaattctgc agatatccag cacagtggcg gccgctcgag tctagagggc ccgcggttcg
      661 aaggtaagcc tatccctaac cctctcctcg gtctcgattc tacgcgtacc ggtcatcatc
      721 accatcacca ttgagtttat ctgactaaat cttagtttgt attgtcatgt tttaatacaa
      781 tatgttatgt ttaaatatgt ttttaataaa ttttataaaa taatttcaac ttttattgta
      841 acaacattgt ccatttacac actcctttca agcgcgtggg atcgatgctc actcaaaggc
      901 ggtaatacgg ttatccacag aatcagggga taacgcagga aagaacatgt gagcaaaagg
      961 ccagcaaaag gccaggaacc gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg
     1021 cccccctgac gagcatcaca aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg
     1081 actataaaga taccaggcgt ttccccctgg aagctccctc gtgcgctctc ctgttccgac
     1141 cctgccgctt accggatacc tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca
     1201 tagctcacgc tgtaggtatc tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt
     1261 gcacgaaccc cccgttcagc ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc
     1321 caacccggta agacacgact tatcgccact ggcagcagcc actggtaaca ggattagcag
     1381 agcgaggtat gtaggcggtg ctacagagtt cttgaagtgg tggcctaact acggctacac
     1441 tagaagaaca gtatttggta tctgcgctct gctgaagcca gttaccttcg gaaaaagagt
     1501 tggtagctct tgatccggca aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa
     1561 gcagcagatt acgcgcagaa aaaaaggatc tcaagaagat cctttgatct tttctacggg
     1621 gtctgacgct cagtggaacg aaaactcacg ttaagggatt ttggtcatgc gaaacacgca
     1681 cggcgcgcgc acgcagctta gcacaaacgc gtcgttgcac gcgcccaccg ctaaccgcag
     1741 gccaatcggt cggccggcct catatccgct caccagccgc gtcctatcgg gcgcggcttc
     1801 cgcgcccatt ttgaataaat aaacgataac gccgttggtg gcgtgaggca tgtaaaaggt
     1861 tacatcatta tcttgttcgc catccggttg gtataaatag acgttcatgt tggtttttgt
     1921 ttcagttgca agttggctgc ggcgcgcgca gcacctttgc cgggatctgc cgggctgcag
     1981 cacgtgttga caattaatca tcggcatagt atatcggcat agtataatac gacaaggtga
     2041 ggaactaaac catggcggta gaaaaaatgg ctagcaaagg agaagaactt ttcactggag
     2101 ttgtcccaat tcttgttgaa ttagatggtg atgttaatgg gcacaaattt tctgtcagtg
     2161 gagagggtga aggtgatgct acatacggaa agcttaccct taaatttatt tgcactactg
     2221 gaaaactacc tgttccatgg ccaacacttg tcactacttt ctcttatggt gttcaatgct
     2281 tttcccgtta tccggatcat atgaaacggc atgacttttt caagagtgcc atgcccgaag
     2341 gtta
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart