pJMP1

$260.00

  • Model: PVT19098
  • 50 Units in Stock
Ask a question


Add to Cart:

pJMP1

PVT19098  2ug

 

pJMP1 Information

Alias: pAX01-dCas9

Prokaryotic resistance: ampicillin Amp

Screening Marker: Erythromycin Erm

Cloning strain: Escherichia coli DH5alpha

Culture conditions: LB medium / 37 C

Expression host: Bacillus subtilis

 

pJMP1 Description

pJMP1 is a gene editing plasmid of Bacillus subtilis.Bacillus subtilis dCas9 expression vector; integrates into lacA/ganA。dcas9 was PCR-amplified from pdCas9-bacteria (Addgene #44249) using primers containing BamHI-compatible BsaI sites, digested with BsaI, then ligated into plasmid pAX01 digested with BamHI to generate pJMP1.

 

pJMP1 Sequence

LOCUS       Exported               12080 bp ds-DNA     circular SYN 14-MAY-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..12080

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     CDS             1087..1278

                     /codon_start=1

                     /gene="rop"

                     /product="Rop protein, which maintains plasmids at low copy

                     number"

                     /note="rop"

                     /translation="MTKQEKTALNMARFIRSQTLTLLEKLNELDADEQADICESLHDHA

                     DELYRSCLARFGDDGENL"

     misc_feature    1380..1520

                     /note="bom"

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(1706..2294)

                     /direction=LEFT

                     /note="ori"

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(2465..3325)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /note="AmpR"

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGYI

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRVDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPAAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(3326..3430)

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             complement(3541..3948)

                     /codon_start=1

                     /note="'lacA"

                     /translation="MKDYATVIDVKTASVEAVYQEDFYARTPAVTSHEYQQGKAYFIGA

                     RLEDQFQRDFYEGLITDLSLSPVFPVRHGKGVSVQARQDQDNDYIFVMNFTEEKQLVTF

                     DQSVKDIMTGDILSGDLTMEKYEVRIVVNTH"

     terminator      4074..4108

                     /note="lambda t0 terminator"

                     /note="minimal transcription terminator from phage lambda 

                     (Scholtissek and Grosse, 1987)"

     CDS             complement(4140..5264)

                     /codon_start=1

                     /note="bme xylR"

                     /translation="MNQKLILDEILKNSPVSRATLSEITGLNKSTVSSQVNTLLEKDFI

                     FEIGAGQSRGGRRPVMLVFNKNAGYSIGIDIGVDYLNGILTDLEGNIILEKTSDLSSSS

                     ASEVKEILFALIHGFVTHMPESPYGLVGIGICVPGLVDRHQQIIFMPNLNWNIKDLQFL

                     IESEFNVPVFVENEANAGAYGEKVFGMTKNYENIVYISINIGIGTGLVINNELYKGVQG

                     FSGEMGHMTIDFNGPKCSCGNRGCWELYASEKALLASLSKEEKNISRKEIVERANKNDV

                     EMLNALQNFGFYIGIGLTNILNTFDIEAVILRNHIIESHPIVLNTIKNEVSSRVHSHLD

                     NKCELLPSSLGKNAPALGAVSIVIDSFLSVTPIS"

     CDS             5580..9686

                     /codon_start=1

                     /product="catalytically dead mutant of the Cas9 

                     endonuclease from the Streptococcus pyogenes Type II 

                     CRISPR/Cas system"

                     /note="dCas9"

                     /note="RNA-guided DNA-binding protein that lacks 

                     endonuclease activity due to the D10A mutation in the RuvC 

                     catalytic domain and the H840A mutation in the HNH 

                     catalytic domain"

                     /translation="MDKKYSIGLAIGTNSVGWAVITDEYKVPSKKFKVLGNTDRHSIKK

                     NLIGALLFDSGETAEATRLKRTARRRYTRRKNRICYLQEIFSNEMAKVDDSFFHRLEES

                     FLVEEDKKHERHPIFGNIVDEVAYHEKYPTIYHLRKKLVDSTDKADLRLIYLALAHMIK

                     FRGHFLIEGDLNPDNSDVDKLFIQLVQTYNQLFEENPINASGVDAKAILSARLSKSRRL

                     ENLIAQLPGEKKNGLFGNLIALSLGLTPNFKSNFDLAEDAKLQLSKDTYDDDLDNLLAQ

                     IGDQYADLFLAAKNLSDAILLSDILRVNTEITKAPLSASMIKRYDEHHQDLTLLKALVR

                     QQLPEKYKEIFFDQSKNGYAGYIDGGASQEEFYKFIKPILEKMDGTEELLVKLNREDLL

                     RKQRTFDNGSIPHQIHLGELHAILRRQEDFYPFLKDNREKIEKILTFRIPYYVGPLARG

                     NSRFAWMTRKSEETITPWNFEEVVDKGASAQSFIERMTNFDKNLPNEKVLPKHSLLYEY

                     FTVYNELTKVKYVTEGMRKPAFLSGEQKKAIVDLLFKTNRKVTVKQLKEDYFKKIECFD

                     SVEISGVEDRFNASLGTYHDLLKIIKDKDFLDNEENEDILEDIVLTLTLFEDREMIEER

                     LKTYAHLFDDKVMKQLKRRRYTGWGRLSRKLINGIRDKQSGKTILDFLKSDGFANRNFM

                     QLIHDDSLTFKEDIQKAQVSGQGDSLHEHIANLAGSPAIKKGILQTVKVVDELVKVMGR

                     HKPENIVIEMARENQTTQKGQKNSRERMKRIEEGIKELGSQILKEHPVENTQLQNEKLY

                     LYYLQNGRDMYVDQELDINRLSDYDVDAIVPQSFLKDDSIDNKVLTRSDKNRGKSDNVP

                     SEEVVKKMKNYWRQLLNAKLITQRKFDNLTKAERGGLSELDKAGFIKRQLVETRQITKH

                     VAQILDSRMNTKYDENDKLIREVKVITLKSKLVSDFRKDFQFYKVREINNYHHAHDAYL

                     NAVVGTALIKKYPKLESEFVYGDYKVYDVRKMIAKSEQEIGKATAKYFFYSNIMNFFKT

                     EITLANGEIRKRPLIETNGETGEIVWDKGRDFATVRKVLSMPQVNIVKKTEVQTGGFSK

                     ESILPKRNSDKLIARKKDWDPKKYGGFDSPTVAYSVLVVAKVEKGKSKKLKSVKELLGI

                     TIMERSSFEKNPIDFLEAKGYKEVKKDLIIKLPKYSLFELENGRKRMLASAGELQKGNE

                     LALPSKYVNFLYLASHYEKLKGSPEDNEQKQLFVEQHKHYLDEIIEQISEFSKRVILAD

                     ANLDKVLSAYNKHRDKPIREQAENIIHLFTLTNLGAPAAFKYFDTTIDRKRYTSTKEVL

                     DATLIHQSITGLYETRIDLSQLGGD"

     terminator      9710..9781

                     /note="rrnB T1 terminator"

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      9797..9824

                     /note="T7Te terminator"

                     /note="phage T7 early transcription terminator"

     promoter        complement(9899..10003)

                     /gene="bla"

                     /note="AmpR promoter"

     CDS             10382..11119

                     /codon_start=1

                     /note="Erm"

                     /translation="MNKNIKYSQNFLTSEKVLNQIIKQLNLKETDTVYEIGTGKGHLTT

                     KLAKISKQVTSIELDSHLFNLSSEKLKLNTRVTLIHQDILQFQFPNKQRYKIVGSIPYH

                     LSTQIIKKVVFESHASDIYLIVEEGFYKRTLDIHRTLGLLLHTQVSIQQLLKLPAECFH

                     PKPKVNSVLIKLTRHTTDVPDKYWKLYTYFVSKWVNREYRQLFTKNQFHQAMKHAKVNN

                     LSTVTYEQVLSIFNSYLLFNGRK"

     terminator      11289..11375

                     /gene="Escherichia coli rrnB"

                     /note="rrnB T1 terminator"

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      11394..11421

                     /note="rrnB T2 terminator"

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

     terminator      11501..11535

                     /note="lambda t0 terminator"

                     /note="minimal transcription terminator from phage lambda 

                     (Scholtissek and Grosse, 1987)"

     CDS             complement(11559..12074)

                     /codon_start=1

                     /note="lacA'"

                     /translation="MSKLEKTHVTKAKFMLHGGDYNPDQWLDRPDILADDIKLMKLSHT

                     NTFSVGIFAWSALEPEEGVYQFEWLDDIFERIHSIGGRVILATPSGARPAWLSQTYPEV

                     LRVNASRVKQLHGGRHNHCLTSKVYREKTRHINRLLAERYGHHPALLMWHISNEYGGDC

                     HCESMRPL"

ORIGIN

        1 atcctgatat tgtctgcatt tgcgccggag caaaccaaaa acctggtgag acacgccttg

       61 aattagtaga aaagaacttg aagattttca aaggcatcgt tagtgaagtc atggcgagcg

      121 gatttgacgg cattttctta gtcgcgacgc gaggctggat ggccttcccc attatgattc

      181 ttctcgcttc cggcggcatc gggatgcccg cgttgcaggc catgctgtcc aggcaggtag

      241 atgacgacca tcagggacag cttcaaggat cgctcgcggc tcttaccagc ctaacttcga

      301 tcactggacc gctgatcgtc acggcgattt atgccgcctc ggcgagcaca tggaacgggt

      361 tggcatggat tgtaggcgcc gccctatacc ttgtctgcct ccccgcgttg cgtcgcggtg

      421 catggagccg ggccacctcg acctgaatgg aagccggcgg cacctcgcta acggattcac

      481 cactccaaga attggagcca atcaattctt gcggagaact gtgaatgcgc aaaccaaccc

      541 ttggcagaac atatccatcg cgtccgccat ctccagcagc cgcacgcggc gcatctcggg

      601 cagcgttggg tcctggccac gggtgcgcat gatcgtgctc ctgtcgttga ggacccggct

      661 aggctggcgg ggttgcctta ctggttagca gaatgaatca ccgatacgcg agcgaacgtg

      721 aagcgactgc tgctgcaaaa cgtctgcgac ctgagcaaca acatgaatgg tcttcggttt

      781 ccgtgtttcg taaagtctgg aaacgcggaa gtcagcgccc tgcaccatta tgttccggat

      841 ctgcatcgca ggatgctgct ggctaccctg tggaacacct acatctgtat taacgaagcg

      901 ctggcattga ccctgagtga tttttctctg gtcccgccgc atccataccg ccagttgttt

      961 accctcacaa cgttccagta accgggcatg ttcatcatca gtaacccgta tcgtgagcat

     1021 cctctctcgt ttcatcggta tcattacccc catgaacaga aattccccct tacacggagg

     1081 catcaagtga ccaaacagga aaaaaccgcc cttaacatgg cccgctttat cagaagccag

     1141 acattaacgc ttctggagaa actcaacgag ctggacgcgg atgaacaggc agacatctgt

     1201 gaatcgcttc acgaccacgc tgatgagctt taccgcagct gcctcgcgcg tttcggtgat

     1261 gacggtgaaa acctctgaca catgcagctc ccggagacgg tcacagcttg tctgtaagcg

     1321 gatgccggga gcagacaagc ccgtcagggc gcgtcagcgg gtgttggcgg gtgtcggggc

     1381 gcagccatga cccagtcacg tagcgatagc ggagtgtata ctggcttaac tatgcggcat

     1441 cagagcagat tgtactgaga gtgcaccata tgcggtgtga aataccgcac agatgcgtaa

     1501 ggagaaaata ccgcatcagg cgctcttccg cttcctcgct cactgactcg ctgcgctcgg

     1561 tcgttcggct gcggcgagcg gtatcagctc actcaaaggc ggtaatacgg ttatccacag

     1621 aatcagggga taacgcagga aagaacatgt gagcaaaagg ccagcaaaag gccaggaacc

     1681 gtaaaaaggc cgcgttgctg gcgtttttcc ataggctccg cccccctgac gagcatcaca

     1741 aaaatcgacg ctcaagtcag aggtggcgaa acccgacagg actataaaga taccaggcgt

     1801 ttccccctgg aagctccctc gtgcgctctc ctgttccgac cctgccgctt accggatacc

     1861 tgtccgcctt tctcccttcg ggaagcgtgg cgctttctca atgctcacgc tgtaggtatc

     1921 tcagttcggt gtaggtcgtt cgctccaagc tgggctgtgt gcacgaaccc cccgttcagc

     1981 ccgaccgctg cgccttatcc ggtaactatc gtcttgagtc caacccggta agacacgact

     2041 tatcgccact ggcagcagcc actggtaaca ggattagcag agcgaggtat gtaggcggtg

     2101 ctacagagtt cttgaagtgg tggcctaact acggctacac tagaaggaca gtatttggta

     2161 tctgcgctct gctgaagcca gttaccttcg gaaaaagagt tggtagctct tgatccggca

     2221 aacaaaccac cgctggtagc ggtggttttt ttgtttgcaa gcagcagatt acgcgcagaa

     2281 aaaaaggatc tcaagaagat cctttgatct tttctacggg gtctgacgct cagtggaacg

     2341 aaaactcacg ttaagggatt ttggtcatga gattatcaaa aaggatcttc acctagatcc

     2401 ttttaaatta aaaatgaagt tttaaatcaa tctaaagtat atatgagtaa acttggtctg

     2461 acagttacca atgcttaatc agtgaggcac ctatctcagc gatctgtcta tttcgttcat

     2521 ccatagttgc ctgactcccc gtcgtgtaga taactacgat acgggagggc ttaccatctg

     2581 gccccagtgc tgcaatgata ccgcgagacc cacgctcacc ggctccagat ttatcagcaa

     2641 taaaccagcc agccggaagg gccgagcgca gaagtggtcc tgcaacttta tccgcctcca

     2701 tccagtctat taattgttgc cgggaagcta gagtaagtag ttcgccagtt aatagtttgc

     2761 gcaacgttgt tgccattgct gcaggcatcg tggtgtcacg ctcgtcgttt ggtatggctt

     2821 cattcagctc cggttcccaa cgatcaaggc gagttacatg atcccccatg ttgtgcaaaa

     2881 aagcggttag ctccttcggt cctccgatcg ttgtcagaag taagttggcc gcagtgttat

     2941 cactcatggt tatggcagca ctgcataatt ctcttactgt catgccatcc gtaagatgct

     3001 tttctgtgac tggtgagtac tcaaccaagt cattctgaga atagtgtatg cggcgaccga

     3061 gttgctcttg cccggcgtca acacgggata ataccgcgcc acatagcaga actttaaaag

     3121 tgctcatcat tggaaaacgt tcttcggggc gaaaactctc aaggatctta ccgctgttga

     3181 gatccagttc gatgtaaccc actcgtgcac ccaactgatc ttcagcatct tttactttca

     3241 ccagcgtttc tgggtgagca aaaacaggaa ggcaaaatgc cgcaaaaaag ggaataaggg

     3301 cgacacggaa atgttgaata ctcatactct tcctttttca atattattga agcatttatc

     3361 agggttattg tctcatgagc ggatacatat ttgaatgtat ttagaaaaat aaacaaatag

     3421 gggttccgcg cacatttccc cgaaaagtgc cacctgacgt ctaagaaacc attattatca

     3481 tgacattaac ctataaaaat aggcgtatca cgaggccctt tcgtcttcaa gaatgatggg

     3541 ctaatgtgtg tttacgacaa ttctcacttc atacttttcc atcgtcaggt cgcctgacaa

     3601 tatgtctcct gtcattatgt ccttcacact ctgatcaaac gtgaccagct gtttttcttc

     3661 cgtgaaattc atgacaaaaa tataatcatt gtcctgatcc tgcctcgctt gtacggagac

     3721 gccttttccg tgccgaaccg gaaaaactgg agagagagac aggtctgtga tcagaccctc

     3781 atagaaatca cgctgaaatt gatcctccaa acgcgcgccg ataaaatacg ccttgccctg

     3841 ctgatactca tggcttgtga ccgctggcgt gcgcgcataa aaatcttctt gatacaccgc

     3901 ttccactgaa gctgtcttta catcaatcac ggttgcataa tccttcattt catatatttg

     3961 gctgcggtag ctgacagcgt ttcgatcctt cggatacagg gtgtccgttt caagaggctc

     4021 aactccaaat atagcttgaa atcgatatct ctgcagtcgc gatgattaat taattcagaa

     4081 cgctcggttg ccgccgggcg ttttttatgc agcaatggca agaacgtccc ggggagctcc

     4141 taacttatag gggtaacact taaaaaagaa tcaataacga tagaaaccgc tcctaaagca

     4201 ggtgcatttt ttcctaacga agaaggcaat agttcacatt tattgtctaa atgagaatgg

     4261 actctagaag aaacttcgtt tttaatcgta tttaaaacaa tgggatgaga ttcaattata

     4321 tgatttctca agataacagc ttctatatca aatgtattaa ggatattggt taatccaatt

     4381 ccgatataaa agccaaagtt ttgaagtgca tttaacattt ctacatcatt tttatttgcg

     4441 cgttccacaa tctcttttcg agaaatattc ttttcttctt tagagagcga agccagtaac

     4501 gctttttcag aagcatataa ttcccaacag cctcgatttc cacagctgca tttgggtcca

     4561 ttaaaatcta tcgtcatatg acccatttcc ccagaaaaac cctgaacacc tttatacaat

     4621 tcgttgttaa taacaagtcc agttccaatt ccgatattaa tactgatgta aacgatgttt

     4681 tcatagtttt ttgtcatacc aaatactttt tcaccgtatg ctcctgcatt agcttcattt

     4741 tcaacaaaaa ccggaacatt aaactcactc tcaattaaaa actgcaaatc tttgatattc

     4801 caatttaagt taggcatgaa aataatttgc tgatgacgat ctacaaggcc tggaacacaa

     4861 attcctattc cgactagacc ataaggggac tcaggcatat gggttacaaa accatgaata

     4921 agtgcaaata aaatctcttt tacttcacta gcggaagaac tagacaagtc agaagtcttc

     4981 tcgagaataa tatttccttc taagtcggtt agaattccgt taagatagtc gactcctata

     5041 tcaataccaa tcgagtagcc tgcattctta ttaaaaacaa gcattacagg tcttctgccg

     5101 cctctagatt gccctgcccc aatttcaaaa ataaaatctt tttcaagcag tgtatttact

     5161 tgagaggaga cagtagactt gtttaatcct gtaatctcag agagagttgc cctggagaca

     5221 ggggagttct tcaaaatttc atctaatatt aatttttgat tcattttttt tactaaagct

     5281 tgatctgcaa tttgaataat aaccactcct ttgtttatcc accgaactaa gttggtgttt

     5341 tttgaagctt gaattagata tttaaaagta tcatatctaa tattataact aaattttcta

     5401 aaaaaaacat tgaaataaac atttattttg tatatgatga gataaagtta gtttattgga

     5461 taaacaaact aactcaatta agatagttga tggataaact tgttcactta aatcaaaggg

     5521 ggaaatgaca aatggtccaa actagtgata tctaaaaatc aaagggggaa atgggatcca

     5581 tggataagaa atactcaata ggcttagcta tcggcacaaa tagcgtcgga tgggcggtga

     5641 tcactgatga atataaggtt ccgtctaaaa agttcaaggt tctgggaaat acagaccgcc

     5701 acagtatcaa aaaaaatctt ataggggctc ttttatttga cagtggagag acagcggaag

     5761 cgactcgtct caaacggaca gctcgtagaa ggtatacacg tcggaagaat cgtatttgtt

     5821 atctacagga gattttttca aatgagatgg cgaaagtaga tgatagtttc tttcatcgac

     5881 ttgaagagtc ttttttggtg gaagaagaca agaagcatga acgtcatcct atttttggaa

     5941 atatagtaga tgaagttgct tatcatgaga aatatccaac tatctatcat ctgcgaaaaa

     6001 aattggtaga ttctactgat aaagcggatt tgcgcttaat ctatttggcc ttagcgcata

     6061 tgattaagtt tcgtggtcat tttttgattg agggagattt aaatcctgat aatagtgatg

     6121 tggacaaact atttatccag ttggtacaaa cctacaatca attatttgaa gaaaacccta

     6181 ttaacgcaag tggagtagat gctaaagcga ttctttctgc acgattgagt aaatcaagac

     6241 gattagaaaa tctcattgct cagctccccg gtgagaagaa aaatggctta tttgggaatc

     6301 tcattgcttt gtcattgggt ttgaccccta attttaaatc aaattttgat ttggcagaag

     6361 atgctaaatt acagctttca aaagatactt acgatgatga tttagataat ttattggcgc

     6421 aaattggaga tcaatatgct gatttgtttt tggcagctaa gaatttatca gatgctattt

     6481 tactttcaga tatcctaaga gtaaatactg aaataactaa ggctccccta tcagcttcaa

     6541 tgattaaacg ctacgatgaa catcatcaag acttgactct tttaaaagct ttagttcgac

     6601 aacaacttcc agaaaagtat aaagaaatct tttttgatca atcaaaaaac ggatatgcag

     6661 gttatattga tgggggagct agccaagaag aattttataa atttatcaaa ccaattttag

     6721 aaaaaatgga tggtactgag gaattattgg tgaaactaaa tcgtgaagat ttgctgcgca

     6781 agcaacggac ctttgacaac ggctctattc cccatcaaat tcacttgggt gagctgcatg

     6841 ctattttgag aagacaagaa gacttttatc catttttaaa agacaatcgt gagaagattg

     6901 aaaaaatctt gacttttcga attccttatt atgttggtcc attggcgcgt ggcaatagtc

     6961 gttttgcatg gatgactcgg aagtctgaag aaacaattac cccatggaat tttgaagaag

     7021 ttgtcgataa aggtgcttca gctcaatcat ttattgaacg catgacaaac tttgataaaa

     7081 atcttccaaa tgaaaaagta ctaccaaaac atagtttgct ttatgagtat tttacggttt

     7141 ataacgaatt gacaaaggtc aaatatgtta ctgaaggaat gcgaaaacca gcatttcttt

     7201 caggtgaaca gaagaaagcc attgttgatt tactcttcaa aacaaatcga aaagtaaccg

     7261 ttaagcaatt aaaagaagat tatttcaaaa aaatagaatg ttttgatagt gttgaaattt

     7321 caggagttga agatagattt aatgcttcat taggtaccta ccatgatttg ctaaaaatta

     7381 ttaaagataa agattttttg gataatgaag aaaatgaaga tatcttagag gatattgttt

     7441 taacattgac cttatttgaa gatagggaga tgattgagga aagacttaaa acatatgctc

     7501 acctctttga tgataaggtg atgaaacagc ttaaacgtcg ccgttatact ggttggggac

     7561 gtttgtctcg aaaattgatt aatggtatta gggataagca atctggcaaa acaatattag

     7621 attttttgaa atcagatggt tttgccaatc gcaattttat gcagctgatc catgatgata

     7681 gtttgacatt taaagaagac attcaaaaag cacaagtgtc tggacaaggc gatagtttac

     7741 atgaacatat tgcaaattta gctggtagcc ctgctattaa aaaaggtatt ttacagactg

     7801 taaaagttgt tgatgaattg gtcaaagtaa tggggcggca taagccagaa aatatcgtta

     7861 ttgaaatggc acgtgaaaat cagacaactc aaaagggcca gaaaaattcg cgagagcgta

     7921 tgaaacgaat cgaagaaggt atcaaagaat taggaagtca gattcttaaa gagcatcctg

     7981 ttgaaaatac tcaattgcaa aatgaaaagc tctatctcta ttatctccaa aatggaagag

     8041 acatgtatgt ggaccaagaa ttagatatta atcgtttaag tgattatgat gtcgatgcca

     8101 ttgttccaca aagtttcctt aaagacgatt caatagacaa taaggtctta acgcgttctg

     8161 ataaaaatcg tggtaaatcg gataacgttc caagtgaaga agtagtcaaa aagatgaaaa

     8221 actattggag acaacttcta aacgccaagt taatcactca acgtaagttt gataatttaa

     8281 cgaaagctga acgtggaggt ttgagtgaac ttgataaagc tggttttatc aaacgccaat

     8341 tggttgaaac tcgccaaatc actaagcatg tggcacaaat tttggatagt cgcatgaata

     8401 ctaaatacga tgaaaatgat aaacttattc gagaggttaa agtgattacc ttaaaatcta

     8461 aattagtttc tgacttccga aaagatttcc aattctataa agtacgtgag attaacaatt

     8521 accatcatgc ccatgatgcg tatctaaatg ccgtcgttgg aactgctttg attaagaaat

     8581 atccaaaact tgaatcggag tttgtctatg gtgattataa agtttatgat gttcgtaaaa

     8641 tgattgctaa gtctgagcaa gaaataggca aagcaaccgc aaaatatttc ttttactcta

     8701 atatcatgaa cttcttcaaa acagaaatta cacttgcaaa tggagagatt cgcaaacgcc

     8761 ctctaatcga aactaatggg gaaactggag aaattgtctg ggataaaggg cgagattttg

     8821 ccacagtgcg caaagtattg tccatgcccc aagtcaatat tgtcaagaaa acagaagtac

     8881 agacaggcgg attctccaag gagtcaattt taccaaaaag aaattcggac aagcttattg

     8941 ctcgtaaaaa agactgggat ccaaaaaaat atggtggttt tgatagtcca acggtagctt

     9001 attcagtcct agtggttgct aaggtggaaa aagggaaatc gaagaagtta aaatccgtta

     9061 aagagttact agggatcaca attatggaaa gaagttcctt tgaaaaaaat ccgattgact

     9121 ttttagaagc taaaggatat aaggaagtta aaaaagactt aatcattaaa ctacctaaat

     9181 atagtctttt tgagttagaa aacggtcgta aacggatgct ggctagtgcc ggagaattac

     9241 aaaaaggaaa tgagctggct ctgccaagca aatatgtgaa ttttttatat ttagctagtc

     9301 attatgaaaa gttgaagggt agtccagaag ataacgaaca aaaacaattg tttgtggagc

     9361 agcataagca ttatttagat gagattattg agcaaatcag tgaattttct aagcgtgtta

     9421 ttttagcaga tgccaattta gataaagttc ttagtgcata taacaaacat agagacaaac

     9481 caatacgtga acaagcagaa aatattattc atttatttac gttgacgaat cttggagctc

     9541 ccgctgcttt taaatatttt gatacaacaa ttgatcgtaa acgatatacg tctacaaaag

     9601 aagttttaga tgccactctt atccatcaat ccatcactgg tctttatgaa acacgcattg

     9661 atttgagtca gctaggaggt gactaactcg agtaaggatc tccaggcatc aaataaaacg

     9721 aaaggctcag tcgaaagact gggcctttcg ttttatctgt tgtttgtcgg tgaacgctct

     9781 ctactagagt cacactggct caccttcggg tgggcctttc tgcgtttata cctagggata

     9841 tattccgctt cctcgctcac tgactcggtc tcggatccga gctcccgcgg gcggccgcac

     9901 tcttcctttt tcaatattat tgaagcattt atcagggtta ttgtctcatg agcggataca

     9961 tatttgaatg tatttagaaa aataaacaaa taggggttcc gcgcacattt ccccgaaaag

    10021 tgccacctga cgtctaagaa accattatta tcatgacatt aacctataaa aataggcgta

    10081 tcacgaggcc ctttcgtctt caagaattga tcctctagca caaaagaaaa acgaaatgat

    10141 acaccaatca gtgcaaaaaa agatataatg ggagataaga cggttcgtgt tcgtgctgac

    10201 ttgcaccata tcataaaaat cgaaacagca aagaatggcg gaaacgtaaa agaagttatg

    10261 gaaataagac ttagaagcaa acttaagagt gtgttgatag tgcagtatct taaaattttg

    10321 tataatagga attgaagtta aattagatgc taaaaatttg taattaagaa ggagtgatta

    10381 catgaacaaa aatataaaat attctcaaaa ctttttaacg agtgaaaaag tactcaacca

    10441 aataataaaa caattgaatt taaaagaaac cgataccgtt tacgaaattg gaacaggtaa

    10501 agggcattta acgacgaaac tggctaaaat aagtaaacag gtaacgtcta ttgaattaga

    10561 cagtcatcta ttcaacttat cgtcagaaaa attaaaactg aatactcgtg tcactttaat

    10621 tcaccaagat attctacagt ttcaattccc taacaaacag aggtataaaa ttgttgggag

    10681 tattccttac catttaagca cacaaattat taaaaaagtg gtttttgaaa gccatgcgtc

    10741 tgacatctat ctgattgttg aagaaggatt ctacaagcgt accttggata ttcaccgaac

    10801 actagggttg ctcttgcaca ctcaagtctc gattcagcaa ttgcttaagc tgccagcgga

    10861 atgctttcat cctaaaccaa aagtaaacag tgtcttaata aaacttaccc gccataccac

    10921 agatgttcca gataaatatt ggaagctata tacgtacttt gtttcaaaat gggtcaatcg

    10981 agaatatcgt caactgttta ctaaaaatca gtttcatcaa gcaatgaaac acgccaaagt

    11041 aaacaattta agtaccgtta cttatgagca agtattgtct atttttaata gttatctatt

    11101 atttaacggg aggaaataat tctatgagtc gcttttgtaa atttggaaag ttacacgtta

    11161 ctaaagggaa tgtagataaa ttattaggta tactactgac agcttccaag gagctaaaga

    11221 ggtccctaga ctctagaccc ggggatctct gcagtgagat ctggtaatga ctctctagct

    11281 tgaggcatca aataaaacga aaggctcagt cgaaagactg ggcctttcgt tttatctgtt

    11341 gtttgtcggt gaacgctctc ctgagtagga caaatccgcc gctctagcta agcagaaggc

    11401 catcctgacg gatggccttt ttgcgtttct acaaactctt gttaactcta gagctgcctg

    11461 ccgcgtttcg gtgatgaaga tcttcccgat gattaattaa ttcagaacgc tcggttgccg

    11521 ccgggcgttt tttatgcagc aatggcaaga acgttgctct agagcggccg catcgattca

    11581 cagtggcaat ctcccccgta ttcgtttgaa atgtgccaca ttaacagcgc cgggtgatgt

    11641 ccgtatcgtt ctgctaataa gcggttgatg tgccgtgttt tttctcggta gactttagat

    11701 gtgaggcagt ggttgtgcct tccgccgtgc agctgtttga cgcgggaggc attgacgcgc

    11761 aaaacttccg gataggtttg cgacagccag gccggacggg ctccgctcgg cgttgctaat

    11821 atgacccggc cgcctatact gtgaatccgc tcaaaaatat catccagcca ttcaaattga

    11881 tatacgccct cctccggctc aagtgcgctc catgcaaaaa tgccgacaga aaacgtattc

    11941 gtatgagaaa gcttcatcag tttgatatcg tcagctaaaa tatcgggccg atccagccac

    12001 tgatcggggt tgtagtctcc cccatggagc ataaattttg cttttgttac gtgcgttttt

    12061 tcaagctttg acatcacccc

//


Caution

Product is for research use only!

 

Search Name

pJMP1, pJMP1 vector, pJMP1 plasmid, pJMP1 Sequence, pJMP1 map

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart