pJV53

$193.00

  • Model: PVT10523
  • 50 Units in Stock
Ask a question


Add to Cart:

pJV53

Catalog No. PVT10523

Packing 2ug

 

pJV53 Information

Function Other source plasmids

Plasmid size: 8812bp

Prokaryotic resistance: kanamycin Kan (50 mu g/ml)

Cloned strains of Escherichia coli, DH5 A and other Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

 

pJV53 Description

pJV53 plasmid provides the Che9c genes 60-61 gene of mycobacteriophage.

 

pJV53  References

Recombineering in Mycobacterium tuberculosis.

 

pJV53 Sequence

LOCUS       Exported                8812 bp ds-DNA     circular SYN 15-AUG-2017
DEFINITION  synthetic circular DNA
FEATURES             Location/Qualifiers
     source          1..8812
                     /organism="synthetic DNA construct"
                     /mol_type="other DNA"
     misc_feature    3617..5615
                     /label=Che9c
                     /note="Gene/Insert name Che9c genes 60-61
                     Species Mycobacteriophage
                     Insert Size (bp) 1998"
     terminator      5680..5726
                     /label=rrnB T1 terminator
                     /note="transcription terminator T1 from the E. coli rrnB 
                     gene"
     CDS             5887..6702
                     /codon_start=1
                     /gene="aph(3')-Ia"
                     /product="aminoglycoside phosphotransferase"
                     /label=KanR
                     /note="confers resistance to kanamycin in bacteria or G418 
                     (Geneticin(R)) in eukaryotes"
                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG
                     KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK
                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA
                     SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI
                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"
     rep_origin      7034..7622
                     /direction=RIGHT
                     /label=ori
                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 
                     replication"
ORIGIN
        1 cggaccgcta ccggacagcg aggtccgcgc catcgccaac agcatttggc gttggatcac
       61 aaccaagtcg cgcatttggg cggacgggat cgtggtctac gaggccacac tcagtgcgcg
      121 ccatgcggcc atctcgcgga agggcgcagc agcgcgcacg gcggcgagca cagttgcgcg
      181 gcgcgcaaag tccgcgtcag ccatggaggc attgctatga gcgacggcta cagcgacggc
      241 tacagcgacg gctacaactg gcagccgact gtccgcaaaa agcggcgcgt gaccgccgcc
      301 gaaggcgctc gaatcaccgg actatccgaa cgccacgtcg tccggctcgt ggcgcaggaa
      361 cgcagcgagt ggttcgccga gcaggctgca cgccgcgaac gcatccgcgc ctatcacgac
      421 gacgagggcc actcttggcc gcaaacggcc aaacatttcg ggctgcatct ggacaccgtt
      481 aagcgactcg gctatcgggc gaggaaagag cgtgcggcag aacaggaagc ggctcaaaag
      541 gcccacaacg aagccgacaa tccaccgctg ttctaacgca attggggagc gggtgtcgcg
      601 ggggttccgt ggggggttcc gttgcaacgg gtcggacagg taaaagtcct ggtagacgct
      661 agttttctgg tttgggccat gcctgtctcg ttgcgtgttt cgttgcgtcc gttttgaata
      721 ccagccagac gagacggggt tctacgaatc ttggtcgata ccaagccatt tccgctgaat
      781 atcgtggagc tcaccgccag aatcggtggt tgtggtgatg tacgtggcga actccgttgt
      841 agtgcttgtg gtggcatccg tggcgcggcc gcggtaccag atctttaaat ctagataaag
      901 aagtgacgcg gtctcaagcg tcgagcgtcg tcagcgtgtc gaggatgtcg aagtcgtagc
      961 cgtcggcgct ggcgatgtag acctgctggt cgaattgact gtcgcgcata cacatcgggc
     1021 cccggggccc gtcgaacccg acatcgtgcg cggatgccat caggtccggt atctcggggg
     1081 agtgggcccg ctggaagatg gcctcgagcg caacgagacc ctcgtaacag gattcggcca
     1141 tcgcgttgag cggtggcgcg tcggcgccgt agcgggcgac gtagctgccc atcaggtcca
     1201 tggcacccgc ggtggccagt gaactgaagt acgccgcggc gacatagagg ttttcggtgg
     1261 agccggcgcc gctggccagc agcatgttct cctccatcag cgggctgaac cgcgccatgc
     1321 ggtcgtgccc gccggcgcgc gcgaactcgc ggttgaacaa cacggcgtcc tggccgacga
     1381 gcagcatcaa cacggcctgc gcccccgacg cgatggcctt gcggaccggt gcgcggaaat
     1441 cgtcggtgcc gtacgggacg tagatctccc gtctgagctc gaggtccaga tctcggcagt
     1501 acgcgcgggc ggccgcggcg gaacggcgcg gccagatgta gtcatcgccg accaggcacc
     1561 aggaccggat gccgaagtgg tcgcgcagcc aggcgagcgc gggcgcgatc tggatctgcg
     1621 gtgtctcgcc tgtgcagaac acgcccggtg tgcgttcacc gccctcgtac aacgaggtgt
     1681 agacgtacgg gatgcggtcg cggaccaccg gggagatgcg gttgcgcacg gccgagatgt
     1741 gccagccggt cacggcgtcg agaccgtgac ctcgcaaccg gtcggcgacg gtccgggcga
     1801 cgtcgtcgcc gggccgtccg ccgtcgagca cctcgatggt gaccttgcgg ccctgcaggc
     1861 cgcctcggtc gttgacctcc ttggccgcga gctcggccac ggcctcgcac gaaggcgcga
     1921 agattcccgc tggcccttga agcggaatca ccagcccgac gcggaactca acctcgccgt
     1981 cctgcactcc agatcaccgt cgatcccgtg tagtctgcgc ttcaaagctt tctagcagaa
     2041 ataattcatt ctgaacagac cccgccgtcg acacgaggag acacccacca tggccgccgg
     2101 acagcagcgc cgccccaacc tcctgctgcc gttggtgcgt ctgacccacc tcgcggagtc
     2161 ggcgatcgaa cgcgtgctcg cggactcgtc gctcaagatc gaggactggc gcgtgctcga
     2221 cgagttggcc ggacggcgca ccgtgcccat gagcgatctc gcgcaggcca cgctgatcac
     2281 gggtccgact ctcaccagaa ccgtcgatcg ccttgtgtcg caagggatca tctaccggac
     2341 tgccgatctg catgaccgcc ggcgggtgct cgtggcgttg accccgcggg ggcggacgct
     2401 gcgcaaccgc ctggtggacg cggtagccga ggccgagtgt gcggcttttg aatcgtgcgg
     2461 gctggacgtc gaccagttgc gcgaactcgt cgacaccacc tcgaatttga cttcgtaacc
     2521 acccgcgccc ggccggcgtt cacccttgac ttttattttc atctggatat atttcgggtg
     2581 aatggaaagg ggtgaccatg ccgacctaca cattccgttg ttcccactgc ggtcccttcg
     2641 atctcacctg cgcgatctcc gagcgcgatg cggcggcgac ctgtccggag tgccggacgc
     2701 cggcgcgccg ggtcttcggt tcggtagggc tgacgacatt caccgcggga catcaccgcg
     2761 cattcgacgc ggcgtccgcg agcgccgaaa gtcccacggt ggtgaagtcg attcccgcag
     2821 gcgcggaccg cccgcgggcc ccgcgccgca atcccggtct accgagtctg ccgaggtact
     2881 agcgacatgg gtggcgtcgg gctcttctac gtgggtgcgg tgctcatcat cgacgggctg
     2941 atgctgctgg gccgcatcag cccacgaggc gcaacaccgc tgaacttctt cgtcggcgga
     3001 ctgcaggtgg tgacgcctac ggtgctgatc ctgcagtccg gcggagacgc ggccgtgatc
     3061 ttcgcggcct ccgggctcta cctgttcggc ttcacctacc tgtgggtggc catcaacaac
     3121 gtgaccgact gggacggaga aggtctcgga tggttctcgc tgttcgtcgc gatcgccgca
     3181 ctcggctact cgtggcacgc gttcaccgcc gaggccgacc cggcgttcgg ggtgatctgg
     3241 ctgctgtggg cagtgctgtg gttcatgctg ttcctgctgc tcggcctggg gcacgacgca
     3301 ctggggcccg ccgtcgggtt cgtcgcggtg gccgaaggcg tgatcaccgc cgccgtgccg
     3361 gccttcctga tcgtgtcggg caactgggaa accggcccgc tccccgccgc ggtcatcgcc
     3421 gtgatcggtt ttgccgcagt tgttctcgca taccccatcg ggcgccgtct cgcagcgccg
     3481 tcagtcacca accctccacc ggccgcgctc gcggccacca cccgataaga gaaagggagt
     3541 ccacatatgt aacggatcca gctgcagaat tcgaagctta tcgatgtcga cgtagttacg
     3601 agatcggcgg ccgcatatga gtgtgcccac acaggacgga atgcaccggt tcgtcgacga
     3661 ggacgtctac cacgctgacc ggggctcgct gtcggtatcc ggcgcgaagc tgctgttgcc
     3721 gccgtcgtgt cccgcgaaat tccgctggga gatggacaac acccggaagc cgaaaaaggt
     3781 ctgggacttc ggacatgtcg cgcacaaact ggtgctcggc aagggtgccg agttcgagat
     3841 cctcgacccc gaggtgcacg ggctgaaggc ggacggtacg ccgtcggaga agccgaccgc
     3901 gacgggcatg tggcgcaagg ccgaggctga ggctcgcaaa cagggcaagg tgccgattca
     3961 cgtcgacctg ttcacgaagg cgtacgacat ggccgaaaag gtgcgtcagc acccgacagc
     4021 cggcccgatc ttcgccaatc ctgacggcga ggccgaggtc gcgctgtact acaccgaccc
     4081 cgagaccggc gtgcggctgc gtggccggat cgactggctc actgacgata tcgatgatta
     4141 caagacgtcg atgaccgcga acccggccga gctgaaaacc aagttctaca agctcggcta
     4201 tttcatgcag gcggcctggt acatcgatct actggtcgcc ctcgggctcg ccgagaaccc
     4261 gcgattccgg ttcatcacgc aggagaaaga accgccctac gtcgtgactc cgatccagta
     4321 cgacgacgag gcgatcgaag aggggcggcg ccgcaaccgc caggcgatcc ggctctacgc
     4381 cgactgcatg gaatcgggca agtggcctga ctacagcgac gacgtggtca cgatcagcct
     4441 gccctcgtgg gggctgccgc gaccgcagac cgtcggcgac gtcgtcaccg acagctatat
No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart