pJV53

$193.00

  • Model: PVT10523
  • 50 Units in Stock
Ask a question


Add to Cart:

pJV53

Catalog No. PVT10523

Packing 2ug

 

pJV53 Information

Function Other source plasmids

Plasmid size: 8812bp

Prokaryotic resistance: kanamycin Kan (50 mu g/ml)

Cloned strains of Escherichia coli, DH5 A and other Escherichia coli

Culture conditions: 37 centigrade, aerobic, LB

 

pJV53 Description

pJV53 plasmid provides the Che9c genes 60-61 gene of mycobacteriophage.

 

pJV53  References

Recombineering in Mycobacterium tuberculosis.

 

pJV53 Sequence

LOCUS       Exported                8812 bp ds-DNA     circular SYN 15-AUG-2017

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..8812

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    3617..5615

                     /label=Che9c

                     /note="Gene/Insert name Che9c genes 60-61

                     Species Mycobacteriophage

                     Insert Size (bp) 1998"

     terminator      5680..5726

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     CDS             5887..6702

                     /codon_start=1

                     /gene="aph(3')-Ia"

                     /product="aminoglycoside phosphotransferase"

                     /label=KanR

                     /note="confers resistance to kanamycin in bacteria or G418 

                     (Geneticin(R)) in eukaryotes"

                     /translation="MSHIQRETSCSRPRLNSNMDADLYGYKWARDNVGQSGATIYRLYG

                     KPHAPELFLKHGKGSVANDVTDEMVRLNWLTEFMPLPTIKHFIRTPDDAWLLTTAIPGK

                     TAFQVLEEYPDSGENIVDALAVFLRRLHSIPVCNCPFNSDRVFRLAQAQSRMNNGLVDA

                     SDFDDERNGWPVEQVWKEMHNLLPFSPDSVVTHGDFSLDNLIFDEGKLIGCIDVGRVGI

                     ADRYQDLAILWNCLGEFSPSLQKRLFQKYGIDNPDMNKLQFHLMLDEFF"

     rep_origin      7034..7622

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

ORIGIN

        1 cggaccgcta ccggacagcg aggtccgcgc catcgccaac agcatttggc gttggatcac

       61 aaccaagtcg cgcatttggg cggacgggat cgtggtctac gaggccacac tcagtgcgcg

      121 ccatgcggcc atctcgcgga agggcgcagc agcgcgcacg gcggcgagca cagttgcgcg

      181 gcgcgcaaag tccgcgtcag ccatggaggc attgctatga gcgacggcta cagcgacggc

      241 tacagcgacg gctacaactg gcagccgact gtccgcaaaa agcggcgcgt gaccgccgcc

      301 gaaggcgctc gaatcaccgg actatccgaa cgccacgtcg tccggctcgt ggcgcaggaa

      361 cgcagcgagt ggttcgccga gcaggctgca cgccgcgaac gcatccgcgc ctatcacgac

      421 gacgagggcc actcttggcc gcaaacggcc aaacatttcg ggctgcatct ggacaccgtt

      481 aagcgactcg gctatcgggc gaggaaagag cgtgcggcag aacaggaagc ggctcaaaag

      541 gcccacaacg aagccgacaa tccaccgctg ttctaacgca attggggagc gggtgtcgcg

      601 ggggttccgt ggggggttcc gttgcaacgg gtcggacagg taaaagtcct ggtagacgct

      661 agttttctgg tttgggccat gcctgtctcg ttgcgtgttt cgttgcgtcc gttttgaata

      721 ccagccagac gagacggggt tctacgaatc ttggtcgata ccaagccatt tccgctgaat

      781 atcgtggagc tcaccgccag aatcggtggt tgtggtgatg tacgtggcga actccgttgt

      841 agtgcttgtg gtggcatccg tggcgcggcc gcggtaccag atctttaaat ctagataaag

      901 aagtgacgcg gtctcaagcg tcgagcgtcg tcagcgtgtc gaggatgtcg aagtcgtagc

      961 cgtcggcgct ggcgatgtag acctgctggt cgaattgact gtcgcgcata cacatcgggc

     1021 cccggggccc gtcgaacccg acatcgtgcg cggatgccat caggtccggt atctcggggg

     1081 agtgggcccg ctggaagatg gcctcgagcg caacgagacc ctcgtaacag gattcggcca

     1141 tcgcgttgag cggtggcgcg tcggcgccgt agcgggcgac gtagctgccc atcaggtcca

     1201 tggcacccgc ggtggccagt gaactgaagt acgccgcggc gacatagagg ttttcggtgg

     1261 agccggcgcc gctggccagc agcatgttct cctccatcag cgggctgaac cgcgccatgc

     1321 ggtcgtgccc gccggcgcgc gcgaactcgc ggttgaacaa cacggcgtcc tggccgacga

     1381 gcagcatcaa cacggcctgc gcccccgacg cgatggcctt gcggaccggt gcgcggaaat

     1441 cgtcggtgcc gtacgggacg tagatctccc gtctgagctc gaggtccaga tctcggcagt

     1501 acgcgcgggc ggccgcggcg gaacggcgcg gccagatgta gtcatcgccg accaggcacc

     1561 aggaccggat gccgaagtgg tcgcgcagcc aggcgagcgc gggcgcgatc tggatctgcg

     1621 gtgtctcgcc tgtgcagaac acgcccggtg tgcgttcacc gccctcgtac aacgaggtgt

     1681 agacgtacgg gatgcggtcg cggaccaccg gggagatgcg gttgcgcacg gccgagatgt

     1741 gccagccggt cacggcgtcg agaccgtgac ctcgcaaccg gtcggcgacg gtccgggcga

     1801 cgtcgtcgcc gggccgtccg ccgtcgagca cctcgatggt gaccttgcgg ccctgcaggc

     1861 cgcctcggtc gttgacctcc ttggccgcga gctcggccac ggcctcgcac gaaggcgcga

     1921 agattcccgc tggcccttga agcggaatca ccagcccgac gcggaactca acctcgccgt

     1981 cctgcactcc agatcaccgt cgatcccgtg tagtctgcgc ttcaaagctt tctagcagaa

     2041 ataattcatt ctgaacagac cccgccgtcg acacgaggag acacccacca tggccgccgg

     2101 acagcagcgc cgccccaacc tcctgctgcc gttggtgcgt ctgacccacc tcgcggagtc

     2161 ggcgatcgaa cgcgtgctcg cggactcgtc gctcaagatc gaggactggc gcgtgctcga

     2221 cgagttggcc ggacggcgca ccgtgcccat gagcgatctc gcgcaggcca cgctgatcac

     2281 gggtccgact ctcaccagaa ccgtcgatcg ccttgtgtcg caagggatca tctaccggac

     2341 tgccgatctg catgaccgcc ggcgggtgct cgtggcgttg accccgcggg ggcggacgct

     2401 gcgcaaccgc ctggtggacg cggtagccga ggccgagtgt gcggcttttg aatcgtgcgg

     2461 gctggacgtc gaccagttgc gcgaactcgt cgacaccacc tcgaatttga cttcgtaacc

     2521 acccgcgccc ggccggcgtt cacccttgac ttttattttc atctggatat atttcgggtg

     2581 aatggaaagg ggtgaccatg ccgacctaca cattccgttg ttcccactgc ggtcccttcg

     2641 atctcacctg cgcgatctcc gagcgcgatg cggcggcgac ctgtccggag tgccggacgc

     2701 cggcgcgccg ggtcttcggt tcggtagggc tgacgacatt caccgcggga catcaccgcg

     2761 cattcgacgc ggcgtccgcg agcgccgaaa gtcccacggt ggtgaagtcg attcccgcag

     2821 gcgcggaccg cccgcgggcc ccgcgccgca atcccggtct accgagtctg ccgaggtact

     2881 agcgacatgg gtggcgtcgg gctcttctac gtgggtgcgg tgctcatcat cgacgggctg

     2941 atgctgctgg gccgcatcag cccacgaggc gcaacaccgc tgaacttctt cgtcggcgga

     3001 ctgcaggtgg tgacgcctac ggtgctgatc ctgcagtccg gcggagacgc ggccgtgatc

     3061 ttcgcggcct ccgggctcta cctgttcggc ttcacctacc tgtgggtggc catcaacaac

     3121 gtgaccgact gggacggaga aggtctcgga tggttctcgc tgttcgtcgc gatcgccgca

     3181 ctcggctact cgtggcacgc gttcaccgcc gaggccgacc cggcgttcgg ggtgatctgg

     3241 ctgctgtggg cagtgctgtg gttcatgctg ttcctgctgc tcggcctggg gcacgacgca

     3301 ctggggcccg ccgtcgggtt cgtcgcggtg gccgaaggcg tgatcaccgc cgccgtgccg

     3361 gccttcctga tcgtgtcggg caactgggaa accggcccgc tccccgccgc ggtcatcgcc

     3421 gtgatcggtt ttgccgcagt tgttctcgca taccccatcg ggcgccgtct cgcagcgccg

     3481 tcagtcacca accctccacc ggccgcgctc gcggccacca cccgataaga gaaagggagt

     3541 ccacatatgt aacggatcca gctgcagaat tcgaagctta tcgatgtcga cgtagttacg

     3601 agatcggcgg ccgcatatga gtgtgcccac acaggacgga atgcaccggt tcgtcgacga

     3661 ggacgtctac cacgctgacc ggggctcgct gtcggtatcc ggcgcgaagc tgctgttgcc

     3721 gccgtcgtgt cccgcgaaat tccgctggga gatggacaac acccggaagc cgaaaaaggt

     3781 ctgggacttc ggacatgtcg cgcacaaact ggtgctcggc aagggtgccg agttcgagat

     3841 cctcgacccc gaggtgcacg ggctgaaggc ggacggtacg ccgtcggaga agccgaccgc

     3901 gacgggcatg tggcgcaagg ccgaggctga ggctcgcaaa cagggcaagg tgccgattca

     3961 cgtcgacctg ttcacgaagg cgtacgacat ggccgaaaag gtgcgtcagc acccgacagc

     4021 cggcccgatc ttcgccaatc ctgacggcga ggccgaggtc gcgctgtact acaccgaccc

     4081 cgagaccggc gtgcggctgc gtggccggat cgactggctc actgacgata tcgatgatta

     4141 caagacgtcg atgaccgcga acccggccga gctgaaaacc aagttctaca agctcggcta

     4201 tttcatgcag gcggcctggt acatcgatct actggtcgcc ctcgggctcg ccgagaaccc

     4261 gcgattccgg ttcatcacgc aggagaaaga accgccctac gtcgtgactc cgatccagta

     4321 cgacgacgag gcgatcgaag aggggcggcg ccgcaaccgc caggcgatcc ggctctacgc

     4381 cgactgcatg gaatcgggca agtggcctga ctacagcgac gacgtggtca cgatcagcct

     4441 gccctcgtgg gggctgccgc gaccgcagac cgtcggcgac gtcgtcaccg acagctatat

     4501 ctacgacacc gacccgctcg aagaggccga cccgattgaa ggggattaca tctatggctg

     4561 aaaatgctgt caccaagcag gattcgccca aggcacccga gacgatctcg caagtgctgc

     4621 aggtgctcgt gccgcagctg gcgcgtgcag tgcccaaggg tatggacccc gaccgcatcg

     4681 cgcggatcgt gcaaaccgag atccgcaagt cgcgcaacgc gaaagctgct ggcatcgcta

     4741 agcagtccct cgacgactgc acgcaagagt catttgccgg tgcgctgctg acctcggccg

     4801 cgctcggtct cgagcccggt gtcaacggcg agtgctacct cgtgccctac cgcgacaccc

     4861 ggcgcggcgt ggtcgagtgc cagctgatca tcggctacca gggcatcgtc aaactgttct

     4921 ggcagcaccc gcgcgcctcc cggatcgacg cgcagtgggt cggcgcgaac gacgaattcc

     4981 attacaccat gggcctcaat ccgacgctga aacacgtgaa ggccaagggt gatcggggta

     5041 atccggtcta cttctacgcg atcgtcgagg tgaccggcgc tgagccgctg tgggacgtgt

     5101 tcaccgccga cgagatcagg gaattgcgtc gcggcaaggt cggatcctcg ggcgacatca

     5161 aggacccgca gcgctggatg gagcggaaga ccgcgctcaa acaggtgctg aagctggcac

     5221 cgaagacgac gcggctcgac gcggcgatcc gcgccgacga tcgcccgggc accgacctgt

     5281 cacagtcgca ggcgctcgcg ctgccgtcga ccgtcaagcc gacggccgac tacatcgacg

     5341 gcgagatcgc cgagccgcac gaggtcgata cgccaccgaa gtcgtcgcgc gcacaacgcg

     5401 cgcagcgcgc caccgcgccg gcgcccgacg tgcagatggc caatcccgat cagctgaagc

     5461 gcctcggcga gatccagaag gccgaaaagt acaacgacgc cgattggttc aagttcctcg

     5521 ccgattcggc cggcgtcaaa gccacgcgcg ccgccgacct cacgttcgac gaggcgaagg

     5581 ctgtcatcga catgttcgac gggcccaacg catgagcgcc ccggcgaatt ccgacgcggt

     5641 ggttgatctg caactagcgt acgatcgact gccaggcatc aaataaaacg aaaggctcag

     5701 tcgaaagact gggcctttcg ttttatgcca tcatggccgc ggtgatcagc tagccacctg

     5761 acgtcggggg ggggggaaag ccacgttgtg tctcaaaatc tctgatgtta cattgcacaa

     5821 gataaaaata tatcatcatg aacaataaaa ctgtctgctt acataaacag taatacaagg

     5881 ggtgttatga gccatattca acgggaaacg tcttgctcga ggccgcgatt aaattccaac

     5941 atggatgctg atttatatgg gtataaatgg gctcgcgata atgtcgggca atcaggtgcg

     6001 acaatctatc gcttgtatgg gaagccccat gcgccagagt tgtttctgaa acatggcaaa

     6061 ggtagcgttg ccaatgatgt tacagatgag atggtcagac taaactggct gacggaattt

     6121 atgcctcttc cgaccatcaa gcattttatc cgtactcctg atgatgcatg gttactcacc

     6181 actgcgatcc ccgggaaaac agcattccag gtattagaag aatatcctga ttcaggtgaa

     6241 aatattgttg atgcgctggc agtgttcctg cgccggttgc attcgattcc tgtttgtaat

     6301 tgtcctttta acagcgatcg cgtatttcgt ctcgctcagg cgcaatcacg aatgaataac

     6361 ggtttggttg atgcgagtga ttttgatgac gagcgtaatg gctggcctgt tgaacaagtc

     6421 tggaaagaaa tgcataatct tttgccattc tcaccggatt cagtcgtcac tcatggtgat

     6481 ttctcacttg ataaccttat ttttgacgag gggaaattaa taggttgtat tgatgttgga

     6541 cgagtcggaa tcgcagaccg ataccaggat cttgccatcc tatggaactg cctcggtgag

     6601 ttttctcctt cattacagaa acggcttttt caaaaatatg gtattgataa tcctgatatg

     6661 aataaattgc agtttcattt gatgctcgat gagtttttct aatcagaatt ggttaattgg

     6721 ttgtaacact ggcagagcat tacgctgact tgacgggacg gcggctttgt tgaataaatc

     6781 gaacttttgc tgagttgaag gatcagatca cgcatcttcc cgacaacgca gaccgttccg

     6841 tggcaaagca aaagttcaaa atcaccaact ggtccaccta caacaaagct ctcatcaacc

     6901 gtggctccct cactttctgg ctggatgatg gggcgattca ggcctggtat gagtcagcaa

     6961 caccttcttc acgaggcaga cctcactagt tccactgagc gtcagacccc gtagaaaaga

     7021 tcaaaggatc ttcttgagat cctttttttc tgcgcgtaat ctgctgcttg caaacaaaaa

     7081 aaccaccgct accagcggtg gtttgtttgc cggatcaaga gctaccaact ctttttccga

     7141 aggtaactgg cttcagcaga gcgcagatac caaatactgt ccttctagtg tagccgtagt

     7201 taggccacca cttcaagaac tctgtagcac cgcctacata cctcgctctg ctaatcctgt

     7261 taccagtggc tgctgccagt ggcgataagt cgtgtcttac cgggttggac tcaagacgat

     7321 agttaccgga taaggcgcag cggtcgggct gaacgggggg ttcgtgcaca cagcccagct

     7381 tggagcgaac gacctacacc gaactgagat acctacagcg tgagcattga gaaagcgcca

     7441 cgcttcccga agggagaaag gcggacaggt atccggtaag cggcagggtc ggaacaggag

     7501 agcgcacgag ggagcttcca gggggaaacg cctggtatct ttatagtcct gtcgggtttc

     7561 gccacctctg acttgagcgt cgatttttgt gatgctcgtc aggggggcgg agcctatgga

     7621 aaaacgccag caacgcggcc tttttacggt tcctggcctt ttgctggcct tttgctcaca

     7681 tgttctttcc tgcgttatcc cctgattctg tggataaccg tattaccgcc tttgagtgag

     7741 ctgataccgc tcgccgcagc cgaacgaccg agcgcaacgc gtgagcccac cagctccgta

     7801 agttcgggtg ctgtgtggct cgtacccgcg cattcaggcg gcagggggtc taacgggtct

     7861 aaggcggcgt gtacggccgc cacagcggct cttagcggcc cggaaacgtc ctcgaaacga

     7921 cgcatgtgtt cctcctggtt ggtacaggtg gttgggggtg ctcggctgtc gctggtgttt

     7981 catcatcagg gctcgacggg agagcggggg agtgtgcagt tgtggggtgg cccctcagcg

     8041 aaatatctga cttggagctc gtgtcggacc atacaccggt gattaatcgt ggtttattat

     8101 caagcgtgag ccacgtcgcc gacgaatttg agcagctctg gctgccgtac tggtccctgg

     8161 caagcgacga tctgctcgag gggatctacc gccaaagccg cgcgtcggcc ctaggccgcc

     8221 ggtacatcga ggcgaaccca acagcgctgg caaacctgct ggtcgtggac gtagaccatc

     8281 cagacgcagc gctccgagcg ctcagcgccc gggggtccca tccgctgccc aacgcgatcg

     8341 tgggcaatcg cgccaacggc cacgcacacg cagtgtgggc actcaacgcc cctgttccac

     8401 gcaccgaata cgcgcggcgt aagccgctcg catacatggc ggcgtgcgcc gaaggccttc

     8461 ggcgcgccgt cgatggcgac cgcagttact caggcctcat gaccaaaaac cccggccaca

     8521 tcgcctggga aacggaatgg ctccactcag atctctacac actcagccac atcgaggccg

     8581 agctcggcgc gaacatgcca ccgccgcgct ggcgtcagca gaccacgtac aaagcggctc

     8641 cgacgccgct agggcggaat tgcgcactgt tcgattccgt caggttgtgg gcctatcttc

     8701 ccgccctcat gcggatctac ctgccgaccc ggaacgtgga cggactcggc cgcgcgatct

     8761 atgccgagtg ccacgcgcga aacgccgaat ttccgtgcaa cgacgtgtgt cc

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart