pJYS2_crtYf

$182.00

  • Model: PVT10657
  • 50 Units in Stock
Ask a question


Add to Cart:

pJYS2_crtYf


Catalog No. PVT10657
Packing 2ug
Function E.coli Editing plasmids
Resistance Spe
Screen /
Strain DH5alpha
Culture temperature 37degrees centigrade
Replicon repA
 

pJYS2_crtYf Descrption

pJYS2_crtYf is an E. coli gRNA expression plasmid.

 

pJYS2_crtYf Sequence

LOCUS       Exported                4380 bp ds-DNA     circular SYN 21-DEC-2017

DEFINITION  Constitutive transcription of crRNA of crtYf, Spectinomycin 

            resistance.

FEATURES             Location/Qualifiers

     source          1..4380

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     terminator      58..143

                     /gene="Escherichia coli rrnB"

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     misc_feature    148..188

                     /label=crRNA

     CDS             complement(522..1985)

                     /codon_start=1

                     /label=repA

                     /translation="MTLADPQDTVTASAWKFSADLFDTHPELALRSRGWTAEDRRELLA

                     HLGRESFQGSKTRDFASAWIKNPDTGETQPKLYRAGSKALTRCQYVALTHAQHAAVIVL

                     DIDVPSHQAGGKIEHVNPQVYAILEKWARLEKAPAWIGVNPLSGKCQLIWLIDPVYAAA

                     GKTSPNMRLLAATTEEMTRVFGADQAFSHRLSRWPLHVSDDPTAYKWHCQHDRVDRLAD

                     LMEIARTMTGSQKPKKYIEQDFSSGRARIEAAQRATAEAKALAILDASLPSALDASGDL

                     IDGVRVLWTNPERAARDETAFRHALTVGYQLKAAGERLKDAKIIDAYEVAYNVAQAVGA

                     DGREPDLPAMRDRLTMARRVRGYVAKGQPVVPARRVETQSSRGRKALATMGRRGAATSN

                     ARRWADPESKYAQETRQRLAEANKRREMTGELLELRVKTAILDARSQSVADPSTRELAG

                     ELGVSERRIQQVRKALGMEAKRGRPRAEN"

     CDS             complement(2391..3065)

                     /codon_start=1

                     /label=Spe

                     /translation="MFGSGVESGLKPNSDLDFLVVVSEPLTDQSKEILIQKIRPISKKI

                     GDKSNLRYIELTIIIQQEMVPWNHPPKQEFIYGEWLQELYEQGYIPQKELNSDLTIMLY

                     QAKRKNKRIYGNYDLEELLPDIPFSDVRRAIMDSSEELIDNYQDDETNSILTLCRMILT

                     MDTGKIIPKDIAGNAVAESSPLEHRERILLAVRSYLGENIEWTNENVNLTINYLNNRLK

                     KL"

     rep_origin      3466..4054

                     /direction=RIGHT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     terminator      4319..4346

                     /label=rrnB T2 terminator

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

ORIGIN

        1 tcctgcccgc caccctccgg gccgttgctt cgcaacgttc aaatccgctc ccggcggatt

       61 tgtcctactc aggagagcgt tcaccgacaa acaacagata aaacgaaagg cccagtcttt

      121 cgactgagcc tttcgtttta tttaaatttc ctgccctatg gttgcctgat ctacaacagt

      181 agaaattcgg atccattata cctaggactg agctagctgt caatctagac tcgaggagat

      241 ttttgagggg gagggagtcg aggaagagcc agagcagaag gcgggggaac cgttctctgc

      301 cgacagcgtg agccccctta aaaatcaggc cggggaggaa ccggggaggg atcagagcta

      361 ggagcgagac accctaaagg gggggaaccg ttttctgctg acggtgtttc gtttattagt

      421 tttcagcccg tggatagcgg agggtgaggg caagtgagag ccagagcaag gacgggaccc

      481 ctaaaggggg gaaccgtttt ctgctgacgg tgtttcgttt attagttttc agcccgtgga

      541 cggccgcgtt tagcttccat tccaagtgcc tttctgactt gttggatgcg cctttcactg

      601 acacctagtt cgcctgcaag ctcacgagtc gagggatcag caaccgattg agaacgggca

      661 tccaggatcg cagttttgac gcgaagttcg agcaactcgc ctgtcatttc tcggcgtttg

      721 tttgcttccg ctaatcgctg tcgcgtctcc tgcgcatact tactttctgg gtcagcccat

      781 ctgcgtgcat tcgatgtagc tgcgccccgt cgccccatcg tcgctagagc tttccgccct

      841 cggctgctct gcgtttccac ccgacgagca gggacgactg gctggccttt agccacgtag

      901 ccgcgcacac gacgcgccat cgtcaggcga tcacgcatgg cgggaagatc cggctcccgg

      961 ccgtctgcac cgaccgcctg ggcaacgttg tacgccactt catacgcgtc gatgatcttg

     1021 gcatctttta ggcgctcacc agcagctttg agctggtatc ccacggtcaa cgcgtggcga

     1081 aacgcggtct cgtcgcgcgc tgcgcgctct ggatttgtcc agagcactcg cacgccgtcg

     1141 atcaggtcgc cggacgcgtc cagggcgctc ggcaggctcg cgtccaaaat cgctagcgcc

     1201 ttggcttctg cggtggcgcg ttgtgccgct tcaatgcggg cgcgtccgct ggaaaagtcc

     1261 tgctcaatgt actttttcgg cttctgtgat ccggtcatcg ttcgagcaat ctccattagg

     1321 tcggccagcc gatccacacg atcatgctgg cagtgccatt tataggctgt cggatcgtct

     1381 gagacgtgca gcggccaccg gctcagccta tgcgaaaaag cctggtcagc gccgaaaaca

     1441 cgagtcattt cttccgtcgt tgcagccagc aggcgcatat ttgggctggt tttacctgct

     1501 gcggcataca ccgggtcaat gagccagatg agctggcatt tcccgctcag cggattcacg

     1561 ccgatccaag ccggcgcttt ttctaggcgt gcccatttct ctaaaatcgc gtagacctgc

     1621 gggtttacgt gctcaatctt cccgccggcc tggtggctgg gcacatcgat gtcaagcacg

     1681 atcaccgcgg catgttgcgc gtgcgtcagc gcaacgtact ggcaccgcgt cagcgctttt

     1741 gagccagccc ggtagagctt tggttgggtt tcgccggtat ccgggttttt aatccaggcg

     1801 ctcgcgaaat ctcttgtctt gctgccctgg aagctttcgc gtcccaggtg agcgagcagt

     1861 tcgcggcgat cttctgccgt ccagccgcgt gagcgcagcg ctagttcggg gtgggtgtcg

     1921 aacagatcgg cggaaaattt ccacgcgcta gctgtgactg tgtcctgcgg atcggctaga

     1981 gtcatgtctt gagtgctttc tcccagctga tgactggggg ttagccgacg ccctgtgagt

     2041 tcccgctcac ggggcgttca actttttcag gtatttgtgc agcttatcgt gttttcttcg

     2101 taaatgaacg cttaactacc ttgttaaacg tggcaaatag gcaggattga tggctttcat

     2161 agaaggcggc ggtggaatcg aaatctcgtg atggcaggtt gggcgtcgct tggtcggtca

     2221 tttcgaaggg caccaataac tgccttaaaa aaagatctgt acatcgatat catatgcaag

     2281 ggtttattgt tttctaaaat ctgattacca attagaatga atatttccca aatattaaat

     2341 aataaaacaa aaaaattgaa aaaagtgttt ccaccatttt ttcaattttt ttataatttt

     2401 tttaatctgt tatttaaata gtttatagtt aaatttacat tttcattagt ccattcaata

     2461 ttctctccaa gataactacg aactgctaac aaaattctct ccctatgttc taatggagaa

     2521 gattcagcca ctgcatttcc cgcaatatct tttggtatga ttttacccgt gtccatagtt

     2581 aaaatcatac ggcataaagt taatatagag ttggtttcat catcctgata attatctatt

     2641 aattcctctg acgaatccat aatggctctt ctcacatcag aaaatggaat atcaggtagt

     2701 aattcctcta agtcataatt tccgtatatt cttttatttt ttcgttttgc ttggtaaagc

     2761 attatggtta aatctgaatt taattccttc tgaggaatgt atccttgttc ataaagctct

     2821 tgtaaccatt ctccataaat aaattcttgt ttgggaggat gattccacgg taccatttct

     2881 tgctgaataa taattgttaa ttcaatatat cgtaagttgc ttttatctcc tatttttttt

     2941 gaaataggtc taattttttg tataagtatt tctttacttt gatctgtcaa tggttcagat

     3001 acgacgacta aaaagtcaag atcactattt ggttttagtc cactctcaac tcctgatcca

     3061 aacatgtaag taccaataag gttatttttt aaatgtttcc gaagtatttt tttcacttta

     3121 ttaatttgtt cgtatgtatt caaatatatc ctcctcacta ttttgattag tacctatttt

     3181 atatccatag ttgttaatta aataaactta atttagttta tttatagatt tcattggctt

     3241 ctaaattttt tatctagata ataattattt tagttaattt tattctagat tatatatgat

     3301 atgatctttc atttccataa aactaaagta agtgtaaacc tattcattgt tttaaaaata

     3361 tctcttgcca gtcacgttac gttattagtt catgaccaaa atcccttaac gtgagttttc

     3421 gttccactga gcgtcagacc ccgtagaaaa gatcaaagga tcttcttgag atcctttttt

     3481 tctgcgcgta atctgctgct tgcaaacaaa aaaaccaccg ctaccagcgg tggtttgttt

     3541 gccggatcaa gagctaccaa ctctttttcc gaaggtaact ggcttcagca gagcgcagat

     3601 accaaatact gtccttctag tgtagccgta gttaggccac cacttcaaga actctgtagc

     3661 accgcctaca tacctcgctc tgctaatcct gttaccagtg gctgctgcca gtggcgataa

     3721 gtcgtgtctt accgggttgg actcaagacg atagttaccg gataaggcgc agcggtcggg

     3781 ctgaacgggg ggttcgtgca cacagcccag cttggagcga acgacctaca ccgaactgag

     3841 atacctacag cgtgagctat gagaaagcgc cacgcttccc gaagggagaa aggcggacag

     3901 gtatccggta agcggcaggg tcggaacagg agagcgcacg agggagcttc cagggggaaa

     3961 cgcctggtat ctttatagtc ctgtcgggtt tcgccacctc tgacttgagc gtcgattttt

     4021 gtgatgctcg tcaggggggc ggagcctatg gaaaaacgcc agcaacgcgg cctttttacg

     4081 gttcctggcc ttttgctggc cttttgctca catgttcttt cctgcgttat cccctgattc

     4141 tgtggataac cgtattaccg cctttgagtg agctgatacc gctcgccgca gccgaacgac

     4201 cgagcgcagc gagtcagtga gcgaggaagc ggaagagcgc ctgatgcggt attttctcct

     4261 tacgcatctg tgcggtattt cacaccgcat atgaagctta agagtttgta gaaacgcaaa

     4321 aaggccatcc gtcaggatgg ccttctgctt aatttgatgc ctggcagttt atggcgggcg

//
 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart