pK7GWIWG2 (I)

$193.00

  • Model: PVT11159
  • 50 Units in Stock
Ask a question


Add to Cart:

pK7GWIWG2(I)


Catalog No. PVT11159
Packing 2ug

 

pK7GWIWG2(I) Information
Function plant expression plasmid
Resistance Spe+Chl
Screen /
Strain DB3.1
Culture temperature 37degrees centigrade

 

pK7GWIWG2(I) Description

pK7GWIWG2(I) is a plant expression plasmid.

 

pK7GWIWG2(I) Sequence

LOCUS       Exported               13599 bp ds-DNA     circular SYN 18-JUN-2017

DEFINITION  synthetic circular DNA

KEYWORDS    pK7GWIWG2(I)

SOURCE      synthetic DNA construct

  ORGANISM  synthetic DNA construct

REFERENCE   1  (bases 1 to 13599)

  AUTHORS   .

  TITLE     Direct Submission

FEATURES             Location/Qualifiers

     source          1..13599

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     misc_feature    28..253

                     /label=35s Terminator

     protein_bind    263..387

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        412..442

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     CDS             496..1155

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     CDS             1497..1802

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     protein_bind    complement(1843..1967)

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     misc_feature    complement(2035..2678)

                     /label=intron

     protein_bind    2693..2817

                     /gene="mutant version of attR"

                     /label=attR2

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     CDS             complement(2858..3163)

                     /codon_start=1

                     /gene="ccdB"

                     /product="CcdB, a bacterial toxin that poisons DNA gyrase"

                     /note="Plasmids containing the ccdB gene cannot be 

                     propagated in standard E. coli strains."

                     /translation="MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDK

                     VSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEVADLSHRENDIKNAINLMFWGI"

     CDS             complement(3505..4164)

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=CmR

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPEFRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     promoter        complement(4218..4248)

                     /label=lac UV5 promoter

                     /note="E. coli lac promoter with an ""up"" mutation"

     protein_bind    complement(4273..4397)

                     /gene="mutant version of attR"

                     /label=attR1

                     /bound_moiety="LR Clonase(TM)"

                     /note="recombination site for the Gateway(R) LR reaction"

     promoter        complement(4425..5460)

                     /label=CaMV 35S promoter

                     /note="strong constitutive promoter from cauliflower mosaic

                     virus"

     misc_feature    5482..5681

                     /label=RB

     misc_feature    5543..5567

                     /label=RB T-DNA repeat

                     /note="right border repeat from nopaline C58 T-DNA"

     CDS             6867..7496

                     /codon_start=1

                     /product="stability protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 StaA

                     /translation="MKVIAVLNQKGGSGKTTIATHLARALQLAGADVLLVDSDPQGSAR

                     DWAAVREDQPLTVVGIDRPTIDRDVKAIGRRDFVVIDGAPQAADLAVSAIKAADFVLIP

                     VQPSPYDIWATADLVELVKQRIEVTDGRLQAAFVVSRAIKGTRIGGEVAEALAGYELPI

                     LESRITQRVSYPGTAAAGTTVLESEPEGDAAREVQALAAEIKSKLI"

     CDS             7930..8997

                     /codon_start=1

                     /product="replication protein from the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

                     /label=pVS1 RepA

                     /translation="GRKPSGPVQIGAALGDDLVEKLKAAQAAQRQRIEAEARPGESWQA

                     AADRIRKESRQPPAAGAPSIRKPPKGDEQPDFFVPMLYDVGTRDSRSIMDVAVFRLSKR

                     DRRAGEVIRYELPDGHVEVSAGPAGMASVWDYDLVLMAVSHLTESMNRYREGKGDKPGR

                     VFRPHVADVLKFCRRADGGKQKDDLVETCIRLNTTHVAMQRTKKAKNGRLVTVSEGEAL

                     ISRYKIVKSETGRPEYIEIELADWMYREITEGKNPDVLTVHPDYFLIDPGIGRFLYRLA

                     RRAAGKAEARWLFKTIYERSGSAGEFKKFCFTVRKLIGSNDLPEYDLKEEAGQAGPILV

                     MRYRNLIEGEASAGS"

     rep_origin      9063..9257

                     /label=pVS1 oriV

                     /note="origin of replication for the Pseudomonas plasmid 

                     pVS1 (Heeb et al., 2000)"

     misc_feature    9601..9741

                     /label=bom

                     /note="basis of mobility region from pBR322"

     rep_origin      complement(9927..10515)

                     /direction=LEFT

                     /label=ori

                     /note="high-copy-number ColE1/pMB1/pBR322/pUC origin of 

                     replication"

     CDS             complement(10759..11550)

                     /codon_start=1

                     /gene="aadA"

                     /product="aminoglycoside adenylyltransferase (Murphy, 

                     1985)"

                     /label=Spe

                     /note="confers resistance to spectinomycin and 

                     streptomycin"

                     /translation="MGEAVIAEVSTQLSEVVGVIERHLEPTLLAVHLYGSAVDGGLKPH

                     SDIDLLVTVTVRLDETTRRALINDLLETSASPGESEILRAVEVTIVVHDDIIPWRYPAK

                     RELQFGEWQRNDILAGIFEPATIDIDLAILLTKAREHSVALVGPAAEELFDPVPEQDLF

                     EALNETLTLWNSPPDWAGDERNVVLTLSRIWYSAVTGKIAPKDVAADWAMERLPAQYQP

                     VILEARQAYLGQEEDRLASRADQLEEFVHYVKGEITKVVGK"

     misc_feature    11840..12172

                     /label=LB

     misc_feature    12078..12102

                     /label=LB T-DNA repeat

                     /note="left border repeat from nopaline C58 T-DNA"

     terminator      12195..12447

                     /label=NOS terminator

                     /note="nopaline synthase terminator and poly(A) signal"

     CDS             complement(12487..13281)

                     /codon_start=1

                     /gene="aph(3')-II (or nptII)"

                     /product="aminoglycoside phosphotransferase from Tn5"

                     /label=NeoR

                     /note="confers resistance to neomycin, kanamycin, and G418 

                     (Geneticin(R))"

                     /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGRP

                     VLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDLLS

                     SHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDEEHQ

                     GLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRYQDIA

                     LATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF"

     promoter        complement(13315..13494)

                     /label=NOS promoter

                     /note="nopaline synthase promoter"

ORIGIN

        1 ctagagggcc cgacgtcgca tgcctgcagg tcactggatt ttggttttag gaattagaaa

       61 ttttattgat agaagtattt tacaaataca aatacatact aagggtttct tatatgctca

      121 acacatgagc gaaaccctat aagaacccta attcccttat ctgggaacta ctcacacatt

      181 attctggaga aaaatagaga gagatagatt tgtagagaga gactggtgat ttttgcggac

      241 tctagcatgg ccgcgggata tcacaagttt gtacaaaaaa gctgaacgag aaacgtaaaa

      301 tgatataaat atcaatatat taaattagat tttgcataaa aaacagacta cataatactg

      361 taaaacacaa catatccagt cactatggcg gccgcattag gcaccccagg ctttacactt

      421 tatgcttccg gctcgtataa tgtgtggatt ttgagttagg atccggcgag attttcagga

      481 gctaaggaag ctaaaatgga gaaaaaaatc actggatata ccaccgttga tatatcccaa

      541 tggcatcgta aagaacattt tgaggcattt cagtcagttg ctcaatgtac ctataaccag

      601 accgttcagc tggatattac ggccttttta aagaccgtaa agaaaaataa gcacaagttt

      661 tatccggcct ttattcacat tcttgcccgc ctgatgaatg ctcatccgga attccgtatg

      721 gcaatgaaag acggtgagct ggtgatatgg gatagtgttc acccttgtta caccgttttc

      781 catgagcaaa ctgaaacgtt ttcatcgctc tggagtgaat accacgacga tttccggcag

      841 tttctacaca tatattcgca agatgtggcg tgttacggtg aaaacctggc ctatttccct

      901 aaagggttta ttgagaatat gtttttcgtc tcagccaatc cctgggtgag tttcaccagt

      961 tttgatttaa acgtggccaa tatggacaac ttcttcgccc ccgttttcac catgggcaaa

     1021 tattatacgc aaggcgacaa ggtgctgatg ccgctggcga ttcaggttca tcatgccgtc

     1081 tgtgatggct tccatgtcgg cagaatgctt aatgaattac aacagtactg cgatgagtgg

     1141 cagggcgggg cgtaaacgcg tggatccggc ttactaaaag ccagataaca gtatgcgtat

     1201 ttgcgcgctg atttttgcgg tataagaata tatactgata tgtatacccg aagtatgtca

     1261 aaaagaggtg tgctatgaag cagcgtatta cagtgacagt tgacagcgac agctatcagt

     1321 tgctcaaggc atatatgatg tcaatatctc cggtctggta agcacaacca tgcagaatga

     1381 agcccgtcgt ctgcgtgccg aacgctggaa agcggaaaat caggaaggga tggctgaggt

     1441 cgcccggttt attgaaatga acggctcttt tgctgacgag aacagggact ggtgaaatgc

     1501 agtttaaggt ttacacctat aaaagagaga gccgttatcg tctgtttgtg gatgtacaga

     1561 gtgatattat tgacacgccc gggcgacgga tggtgatccc cctggccagt gcacgtctgc

     1621 tgtcagataa agtctcccgt gaactttacc cggtggtgca tatcggggat gaaagctggc

     1681 gcatgatgac caccgatatg gccagtgtgc cggtctccgt tatcggggaa gaagtggctg

     1741 atctcagcca ccgcgaaaat gacatcaaaa acgccattaa cctgatgttc tggggaatat

     1801 aaatgtcagg ctcccttata cacagccagt ctgcaggtcg accatagtga ctggatatgt

     1861 tgtgttttac agtattatgt agtctgtttt ttatgcaaaa tctaatttaa tatattgata

     1921 tttatatcat tttacgtttc tcgttcagct ttcttgtaca aagtggtgat atcactagtg

     1981 cggccgcctg caggtcgacc atatggtcga cctgcaggcg gccgcactag tgatgctgtt

     2041 atgttcagtg tcaagctgac ctgcaaacac gttaaatgct aagaagttag aatatatgag

     2101 acacgttaac tggtatatga ataagctgta aataaccgag tataaactca ttaactaata

     2161 tcacctctag agtataatat aatcaaattc gacaatttga ctttcaagag taggctaatg

     2221 taaaatcttt atatatttct acaatgttca aagaaacagt tgcatctaaa cccctatggc

     2281 catcaaattc aatgaacgct aagcttaata tgactctcaa taaagtctca taccaacaag

     2341 tgccacctta ttcaaccatc aagaaaaaag ccaaaattta tgctactcta aggaaaactt

     2401 cactaaagaa gacgatttag agtgttttac caagaatttc tgtcatctta ctaaacaact

     2461 aaagatcggt gtgatacaaa acctaatctc attaaagttt atgctaaaat aagcataatt

     2521 ttacccacta agcgtgacca gataaacata actcagcaca ccagagcata tatattggtg

     2581 gctcaaatca tagaaactta cagtgaagac acagaaagcc gtaagaagag gcaagagtat

     2641 gaaaccttac ctcatcattt ccatgaggtt gcttctgatc ccgcgggata tcaccacttt

     2701 gtacaagaaa gctgaacgag aaacgtaaaa tgatataaat atcaatatat taaattagat

     2761 tttgcataaa aaacagacta cataatactg taaaacacaa catatccagt cactatggtc

     2821 gacctgcaga ctggctgtgt ataagggagc ctgacattta tattccccag aacatcaggt

     2881 taatggcgtt tttgatgtca ttttcgcggt ggctgagatc agccacttct tccccgataa

     2941 cggagaccgg cacactggcc atatcggtgg tcatcatgcg ccagctttca tccccgatat

     3001 gcaccaccgg gtaaagttca cgggagactt tatctgacag cagacgtgca ctggccaggg

     3061 ggatcaccat ccgtcgcccg ggcgtgtcaa taatatcact ctgtacatcc acaaacagac

     3121 gataacggct ctctctttta taggtgtaaa ccttaaactg catttcacca gtccctgttc

     3181 tcgtcagcaa aagagccgtt catttcaata aaccgggcga cctcagccat cccttcctga

     3241 ttttccgctt tccagcgttc ggcacgcaga cgacgggctt cattctgcat ggttgtgctt

     3301 accagaccgg agatattgac atcatatatg ccttgagcaa ctgatagctg tcgctgtcaa

     3361 ctgtcactgt aatacgctgc ttcatagcac acctcttttt gacatacttc gggtatacat

     3421 atcagtatat attcttatac cgcaaaaatc agcgcgcaaa tacgcatact gttatctggc

     3481 ttttagtaag ccggatccac gcgtttacgc cccgccctgc cactcatcgc agtactgttg

     3541 taattcatta agcattctgc cgacatggaa gccatcacag acggcatgat gaacctgaat

     3601 cgccagcggc atcagcacct tgtcgccttg cgtataatat ttgcccatgg tgaaaacggg

     3661 ggcgaagaag ttgtccatat tggccacgtt taaatcaaaa ctggtgaaac tcacccaggg

     3721 attggctgag acgaaaaaca tattctcaat aaacccttta gggaaatagg ccaggttttc

     3781 accgtaacac gccacatctt gcgaatatat gtgtagaaac tgccggaaat cgtcgtggta

     3841 ttcactccag agcgatgaaa acgtttcagt ttgctcatgg aaaacggtgt aacaagggtg

     3901 aacactatcc catatcacca gctcaccgtc tttcattgcc atacggaatt ccggatgagc

     3961 attcatcagg cgggcaagaa tgtgaataaa ggccggataa aacttgtgct tatttttctt

     4021 tacggtcttt aaaaaggccg taatatccag ctgaacggtc tggttatagg tacattgagc

     4081 aactgactga aatgcctcaa aatgttcttt acgatgccat tgggatatat caacggtggt

     4141 atatccagtg atttttttct ccattttagc ttccttagct cctgaaaatc tcgccggatc

     4201 ctaactcaaa atccacacat tatacgagcc ggaagcataa agtgtaaagc ctggggtgcc

     4261 taatgcggcc gccatagtga ctggatatgt tgtgttttac agtattatgt agtctgtttt

     4321 ttatgcaaaa tctaatttaa tatattgata tttatatcat tttacgtttc tcgttcagct

     4381 tttttgtaca aacttgtgat atcactagtg cggccgcctg caggtcgact agaatagtaa

     4441 attgtaatgt tgtttgttgt ttgttttgtt gtggtaattg ttgtaaaaat acggatcgtc

     4501 ctgcagtcct ctccaaatga aatgaacttc cttatataga ggaagggtct tgcgaaggat

     4561 agtgggattg tgcgtcatcc cttacgtcag tggagatatc acatcaatcc acttgctttg

     4621 aagacgtggt tggaacgtct tctttttcca cgatgctcct cgtgggtggg ggtccatctt

     4681 tgggaccact gtcggcagag gcatcttgaa cgatagcctt tcctttatcg caatgatggc

     4741 atttgtaggt gccaccttcc ttttctactg tccttttgat gaagtgacag atagctgggc

     4801 aatggaatcc gaggaggttt cccgatatta ccctttgttg aaaagtctca atagcccttt

     4861 ggtcttctga gactgtatct ttgatattct tggagtagac gagagtgtcg tgctccacca

     4921 tgttgacgaa gattttcttc ttgtcattga gtcgtaaaag actctgtatg aactgttcgc

     4981 cagtcttcac ggcgagttct gttagatcct cgatctgaat ttttgactcc atggcctttg

     5041 attcagtagg aactactttc ttagagactc caatctctat tacttgcctt ggtttatgaa

     5101 gcaagccttg aatcgtccat actggaatag tacttctgat cttgagaaat atatctttct

     5161 ctgtgttctt gatgcagtta gtcctgaatc ttttgactgc atctttaacc ttcttgggaa

     5221 ggtatttgat ctcctggaga ttattactcg ggtagatcgt cttgatgaga cctgccgcgt

     5281 aggcctctct aaccatctgt gggtcagcat tctttctgaa attgaagagg ctaatcttct

     5341 cattatcggt ggtgaacatg gtatcgtcac cttctccgtc gaactttctt cctagatcgt

     5401 agagatagag aaagtcgtcc atggtgatct ccggggcaaa ggagatcagc ttggctctag

     5461 tcgaccatat gggagagctc aagcttagct tgagcttgga tcagattgtc gtttcccgcc

     5521 ttcagtttaa actatcagtg tttgacagga tatattggcg ggtaaaccta agagaaaaga

     5581 gcgtttatta gaataacgga tatttaaaag ggcgtgaaaa ggtttatccg ttcgtccatt

     5641 tgtatgtgca tgccaaccac agggttcccc tcgggatcaa agtactttga tccaacccct

     5701 ccgctgctat agtgcagtcg gcttctgacg ttcagtgcag ccgtcttctg aaaacgacat

     5761 gtcgcacaag tcctaagtta cgcgacaggc tgccgccctg cccttttcct ggcgttttct

     5821 tgtcgcgtgt tttagtcgca taaagtagaa tacttgcgac tagaaccgga gacattacgc

     5881 catgaacaag agcgccgccg ctggcctgct gggctatgcc cgcgtcagca ccgacgacca

     5941 ggacttgacc aaccaacggg ccgaactgca cgcggccggc tgcaccaagc tgttttccga

     6001 gaagatcacc ggcaccaggc gcgaccgccc ggagctggcc aggatgcttg accacctacg

     6061 ccctggcgac gttgtgacag tgaccaggct agaccgcctg gcccgcagca cccgcgacct

     6121 actggacatt gccgagcgca tccaggaggc cggcgcgggc ctgcgtagcc tggcagagcc

     6181 gtgggccgac accaccacgc cggccggccg catggtgttg accgtgttcg ccggcattgc

     6241 cgagttcgag cgttccctaa tcatcgaccg cacccggagc gggcgcgagg ccgccaaggc

     6301 ccgaggcgtg aagtttggcc cccgccctac cctcaccccg gcacagatcg cgcacgcccg

     6361 cgagctgatc gaccaggaag gccgcaccgt gaaagaggcg gctgcactgc ttggcgtgca

     6421 tcgctcgacc ctgtaccgcg cacttgagcg cagcgaggaa gtgacgccca ccgaggccag

     6481 gcggcgcggt gccttccgtg aggacgcatt gaccgaggcc gacgccctgg cggccgccga

     6541 gaatgaacgc caagaggaac aagcatgaaa ccgcaccagg acggccagga cgaaccgttt

     6601 ttcattaccg aagagatcga ggcggagatg atcgcggccg ggtacgtgtt cgagccgccc

     6661 gcgcacgtct caaccgtgcg gctgcatgaa atcctggccg gtttgtctga tgccaagctg

     6721 gcggcctggc cggccagctt ggccgctgaa gaaaccgagc gccgccgtct aaaaaggtga

     6781 tgtgtatttg agtaaaacag cttgcgtcat gcggtcgctg cgtatatgat gcgatgagta

     6841 aataaacaaa tacgcaaggg gaacgcatga aggttatcgc tgtacttaac cagaaaggcg

     6901 ggtcaggcaa gacgaccatc gcaacccatc tagcccgcgc cctgcaactc gccggggccg

     6961 atgttctgtt agtcgattcc gatccccagg gcagtgcccg cgattgggcg gccgtgcggg

     7021 aagatcaacc gctaaccgtt gtcggcatcg accgcccgac gattgaccgc gacgtgaagg

     7081 ccatcggccg gcgcgacttc gtagtgatcg acggagcgcc ccaggcggcg gacttggctg

     7141 tgtccgcgat caaggcagcc gacttcgtgc tgattccggt gcagccaagc ccttacgaca

     7201 tatgggccac cgccgacctg gtggagctgg ttaagcagcg cattgaggtc acggatggaa

     7261 ggctacaagc ggcctttgtc gtgtcgcggg cgatcaaagg cacgcgcatc ggcggtgagg

     7321 ttgccgaggc gctggccggg tacgagctgc ccattcttga gtcccgtatc acgcagcgcg

     7381 tgagctaccc aggcactgcc gccgccggca caaccgttct tgaatcagaa cccgagggcg

     7441 acgctgcccg cgaggtccag gcgctggccg ctgaaattaa atcaaaactc atttgagtta

     7501 atgaggtaaa gagaaaatga gcaaaagcac aaacacgcta agtgccggcc gtccgagcgc

     7561 acgcagcagc aaggctgcaa cgttggccag cctggcagac acgccagcca tgaagcgggt

     7621 caactttcag ttgccggcgg aggatcacac caagctgaag atgtacgcgg tacgccaagg

     7681 caagaccatt accgagctgc tatctgaata catcgcgcag ctaccagagt aaatgagcaa

     7741 atgaataaat gagtagatga attttagcgg ctaaaggagg cggcatggaa aatcaagaac

     7801 aaccaggcac cgacgccgtg gaatgcccca tgtgtggagg aacgggcggt tggccaggcg

     7861 taagcggctg ggttgtctgc cggccctgca atggcactgg aacccccaag cccgaggaat

     7921 cggcgtgacg gtcgcaaacc atccggcccg gtacaaatcg gcgcggcgct gggtgatgac

     7981 ctggtggaga agttgaaggc cgcgcaggcc gcccagcggc aacgcatcga ggcagaagca

     8041 cgccccggtg aatcgtggca agcggccgct gatcgaatcc gcaaagaatc ccggcaaccg

     8101 ccggcagccg gtgcgccgtc gattaggaag ccgcccaagg gcgacgagca accagatttt

     8161 ttcgttccga tgctctatga cgtgggcacc cgcgatagtc gcagcatcat ggacgtggcc

     8221 gttttccgtc tgtcgaagcg tgaccgacga gctggcgagg tgatccgcta cgagcttcca

     8281 gacgggcacg tagaggtttc cgcagggccg gccggcatgg ccagtgtgtg ggattacgac

     8341 ctggtactga tggcggtttc ccatctaacc gaatccatga accgataccg ggaagggaag

     8401 ggagacaagc ccggccgcgt gttccgtcca cacgttgcgg acgtactcaa gttctgccgg

     8461 cgagccgatg gcggaaagca gaaagacgac ctggtagaaa cctgcattcg gttaaacacc

     8521 acgcacgttg ccatgcagcg tacgaagaag gccaagaacg gccgcctggt gacggtatcc

     8581 gagggtgaag ccttgattag ccgctacaag atcgtaaaga gcgaaaccgg gcggccggag

     8641 tacatcgaga tcgagctagc tgattggatg taccgcgaga tcacagaagg caagaacccg

     8701 gacgtgctga cggttcaccc cgattacttt ttgatcgatc ccggcatcgg ccgttttctc

     8761 taccgcctgg cacgccgcgc cgcaggcaag gcagaagcca gatggttgtt caagacgatc

     8821 tacgaacgca gtggcagcgc cggagagttc aagaagttct gtttcaccgt gcgcaagctg

     8881 atcgggtcaa atgacctgcc ggagtacgat ttgaaggagg aggcggggca ggctggcccg

     8941 atcctagtca tgcgctaccg caacctgatc gagggcgaag catccgccgg ttcctaatgt

     9001 acggagcaga tgctagggca aattgcccta gcaggggaaa aaggtcgaaa aggtctcttt

     9061 cctgtggata gcacgtacat tgggaaccca aagccgtaca ttgggaaccg gaacccgtac

     9121 attgggaacc caaagccgta cattgggaac cggtcacaca tgtaagtgac tgatataaaa

     9181 gagaaaaaag gcgatttttc cgcctaaaac tctttaaaac ttattaaaac tcttaaaacc

     9241 cgcctggcct gtgcataact gtctggccag cgcacagccg aagagctgca aaaagcgcct

     9301 acccttcggt cgctgcgctc cctacgcccc gccgcttcgc gtcggcctat cgcggccgct

     9361 ggccgctcaa aaatggctgg cctacggcca ggcaatctac cagggcgcgg acaagccgcg

     9421 ccgtcgccac tcgaccgccg gcgcccacat caaggcaccc tgcctcgcgc gtttcggtga

     9481 tgacggtgaa aacctctgac acatgcagct cccggagacg gtcacagctt gtctgtaagc

     9541 ggatgccggg agcagacaag cccgtcaggg cgcgtcagcg ggtgttggcg ggtgtcgggg

     9601 cgcagccatg acccagtcac gtagcgatag cggagtgtat actggcttaa ctatgcggca

     9661 tcagagcaga ttgtactgag agtgcaccat atgcggtgtg aaataccgca cagatgcgta

     9721 aggagaaaat accgcatcag gcgctcttcc gcttcctcgc tcactgactc gctgcgctcg

     9781 gtcgttcggc tgcggcgagc ggtatcagct cactcaaagg cggtaatacg gttatccaca

     9841 gaatcagggg ataacgcagg aaagaacatg tgagcaaaag gccagcaaaa ggccaggaac

     9901 cgtaaaaagg ccgcgttgct ggcgtttttc cataggctcc gcccccctga cgagcatcac

     9961 aaaaatcgac gctcaagtca gaggtggcga aacccgacag gactataaag ataccaggcg

    10021 tttccccctg gaagctccct cgtgcgctct cctgttccga ccctgccgct taccggatac

    10081 ctgtccgcct ttctcccttc gggaagcgtg gcgctttctc atagctcacg ctgtaggtat

    10141 ctcagttcgg tgtaggtcgt tcgctccaag ctgggctgtg tgcacgaacc ccccgttcag

    10201 cccgaccgct gcgccttatc cggtaactat cgtcttgagt ccaacccggt aagacacgac

    10261 ttatcgccac tggcagcagc cactggtaac aggattagca gagcgaggta tgtaggcggt

    10321 gctacagagt tcttgaagtg gtggcctaac tacggctaca ctagaaggac agtatttggt

    10381 atctgcgctc tgctgaagcc agttaccttc ggaaaaagag ttggtagctc ttgatccggc

    10441 aaacaaacca ccgctggtag cggtggtttt tttgtttgca agcagcagat tacgcgcaga

    10501 aaaaaaggat ctcaagaaga tcctttgatc ttttctacgg ggtctgacgc tcagtggaac

    10561 gaaaactcac gttaagggat tttggtcatg catgatatat ctcccaattt gtgtagggct

    10621 tattatgcac gcttaaaaat aataaaagca gacttgacct gatagtttgg ctgtgagcaa

    10681 ttatgtgctt agtgcatcta atcgcttgag ttaacgccgg cgaagcggcg tcggcttgaa

    10741 cgaatttcta gctagacatt atttgccgac taccttggtg atctcgcctt tcacgtagtg

    10801 gacaaattct tccaactgat ctgcgcgcga ggccaagcga tcttcttctt gtccaagata

    10861 agcctgtcta gcttcaagta tgacgggctg atactgggcc ggcaggcgct ccattgccca

    10921 gtcggcagcg acatccttcg gcgcgatttt gccggttact gcgctgtacc aaatgcggga

    10981 caacgtaagc actacatttc gctcatcgcc agcccagtcg ggcggcgagt tccatagcgt

    11041 taaggtttca tttagcgcct caaatagatc ctgttcagga accggatcaa agagttcctc

    11101 cgccgctgga cctaccaagg caacgctatg ttctcttgct tttgtcagca agatagccag

    11161 atcaatgtcg atcgtggctg gctcgaagat acctgcaaga atgtcattgc gctgccattc

    11221 tccaaattgc agttcgcgct tagctggata acgccacgga atgatgtcgt cgtgcacaac

    11281 aatggtgact tctacagcgc ggagaatctc gctctctcca ggggaagccg aagtttccaa

    11341 aaggtcgttg atcaaagctc gccgcgttgt ttcatcaagc cttacggtca ccgtaaccag

    11401 caaatcaata tcactgtgtg gcttcaggcc gccatccact gcggagccgt acaaatgtac

    11461 ggccagcaac gtcggttcga gatggcgctc gatgacgcca actacctctg atagttgagt

    11521 cgatacttcg gcgatcaccg cttcccccat gatgtttaac tttgttttag ggcgactgcc

    11581 ctgctgcgta acatcgttgc tgctccataa catcaaacat cgacccacgg cgtaacgcgc

    11641 ttgctgcttg gatgcccgag gcatagactg taccccaaaa aaacatgtca taacaagaag

    11701 ccatgaaaac cgccactgcg ccgttaccac cgctgcgttc ggtcaaggtt ctggaccagt

    11761 tgcgtgacgg cagttacgct acttgcatta cagcttacga accgaacgag gcttatgtcc

    11821 actgggttcg tgcccgaatt gatcacaggc agcaacgctc tgtcatcgtt acaatcaaca

    11881 tgctaccctc cgcgagatca tccgtgtttc aaacccggca gcttagttgc cgttcttccg

    11941 aatagcatcg gtaacatgag caaagtctgc cgccttacaa cggctctccc gctgacgccg

    12001 tcccggactg atgggctgcc tgtatcgagt ggtgattttg tgccgagctg ccggtcgggg

    12061 agctgttggc tggctggtgg caggatatat tgtggtgtaa acaaattgac gcttagacaa

    12121 cttaataaca cattgcggac gtttttaatg tactgaatta acgccgaatt gaattatcag

    12181 cttgcatgcc ggtcgatcta gtaacataga tgacaccgcg cgcgataatt tatcctagtt

    12241 tgcgcgctat attttgtttt ctatcgcgta ttaaatgtat aattgcggga ctctaatcat

    12301 aaaaacccat ctcataaata acgtcatgca ttacatgtta attattacat gcttaacgta

    12361 attcaacaga aattatatga taatcatcgc aagaccggca acaggattca atcttaagaa

    12421 actttattgc caaatgtttg aacgatctgc ttgactctag ctagagtccg aaccccagag

    12481 tcccgctcag aagaactcgt caagaaggcg atagaaggcg atgcgctgcg aatcgggagc

    12541 ggcgataccg taaagcacga ggaagcggtc agcccattcg ccgccaagct cttcagcaat

    12601 atcacgggta gccaacgcta tgtcctgata gcggtccgcc acacccagcc ggccacagtc

    12661 gatgaatcca gaaaagcggc cattttccac catgatattc ggcaagcagg catcgccgtg

    12721 ggtcacgacg agatcctcgc cgtcgggcat ccgcgccttg agcctggcga acagttcggc

    12781 tggcgcgagc ccctgatgct cttcgtccag atcatcctga tcgacaagac cggcttccat

    12841 ccgagtacgt gctcgctcga tgcgatgttt cgcttggtgg tcgaatgggc aggtagccgg

    12901 atcaagcgta tgcagccgcc gcattgcatc agccatgatg gatactttct cggcaggagc

    12961 aaggtgagat gacaggagat cctgccccgg cacttcgccc aatagcagcc agtcccttcc

    13021 cgcttcagtg acaacgtcga gcacagctgc gcaaggaacg cccgtcgtgg ccagccacga

    13081 tagccgcgct gcctcgtctt ggagttcatt cagggcaccg gacaggtcgg tcttgacaaa

    13141 aagaaccggg cgcccctgcg ctgacagccg gaacacggcg gcatcagagc agccgattgt

    13201 ctgttgtgcc cagtcatagc cgaatagcct ctccacccaa gcggccggag aacctgcgtg

    13261 caatccatct tgttcaatca tgcctcgatc gagttgagag tgaatatgag actctaattg

    13321 gataccgagg ggaatttatg gaacgtcagt ggagcatttt tgacaagaaa tatttgctag

    13381 ctgatagtga ccttaggcga cttttgaacg cgcaataatg gtttctgacg tatgtgctta

    13441 gctcattaaa ctccagaaac ccgcggctga gtggctcctt caacgttgcg gttctgtcag

    13501 ttccaaacgt aaaacggctt gtcccgcgtc atcggcgggg gtcataacgt gactccctta

    13561 attctcatgt atgataattc gagggtaccc ggggatcct

//

 

Caution:
Product is for research use only!

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart