pKD3

$216.00

  • Model: PVT6001
  • 49 Units in Stock
Ask a question


Add to Cart:

pKD3

PVT6001    2ug

 

pKD3 information

Prokaryotic resistance: ampicillin Amp, chloramphenicol Chl
Cloned strain: Escherichia coli DH5 alpha
Culture conditions: 37 degrees centigrade
Expression host: Escherichia coli
Use:Homologous recombination HR plasmid

 

pKD3 description

PKD3 is a gene knockout plasmid for the Red system of Escherichia coli.

 

pKD3  References

Datsenko, KA, BL Wanner 2000. One-step inactivation of chromosomal genes in Escherichia coli K-12 using PCR products. Proc. Natl. Acad. Sci. U.S.A. 97(12):6640-5.

 

pKD3  sequence

LOCUS       Exported                2806 bp ds-DNA     circular SYN 27-JAN-2018

DEFINITION  synthetic circular DNA

FEATURES             Location/Qualifiers

     source          1..2806

                     /organism="synthetic DNA construct"

                     /mol_type="other DNA"

     protein_bind    complement(51..98)

                     /label=FRT

                     /bound_moiety="FLP recombinase from the Saccharomyces 

                     cerevisiae 2u plasmid"

                     /note="FLP-mediated recombination occurs in the 8-bp core 

                     sequence TCTAGAAA (Turan and Bode, 2011)."

     CDS             complement(115..774)

                     /codon_start=1

                     /gene="cat"

                     /product="chloramphenicol acetyltransferase"

                     /label=Chl

                     /note="confers resistance to chloramphenicol"

                     /translation="MEKKITGYTTVDISQWHRKEHFEAFQSVAQCTYNQTVQLDITAFL

                     KTVKKNKHKFYPAFIHILARLMNAHPELRMAMKDGELVIWDSVHPCYTVFHEQTETFSS

                     LWSEYHDDFRQFLHIYSQDVACYGENLAYFPKGFIENMFFVSANPWVSFTSFDLNVANM

                     DNFFAPVFTMGKYYTQGDKVLMPLAIQVHHAVCDGFHVGRMLNELQQYCDEWQGGA"

     promoter        complement(775..877)

                     /label=cat promoter

                     /note="promoter of the E. coli cat gene encoding 

                     chloramphenicol acetyltransferase"

     protein_bind    complement(983..1016)

                     /label=FRT (minimal)

                     /bound_moiety="FLP recombinase from the Saccharomyces 

                     cerevisiae 2u plasmid"

                     /note="supports FLP-mediated excision but not integration 

                     (Turan and Bode, 2011)"

     rep_origin      1065..1421

                     /label=R6K gamma ori

                     /note="gamma replication origin from E. coli plasmid R6K; 

                     requires the R6K initiator protein pi for replication"

     CDS             complement(1518..2378)

                     /codon_start=1

                     /gene="bla"

                     /product="beta-lactamase"

                     /label=Amp

                     /note="confers resistance to ampicillin, carbenicillin, and

                     related antibiotics"

                     /translation="[TEM beta-lactamase fragment, 45 aa]

                     ELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVEYS

                     PVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRLDRW

                     EPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPLLRSA

                     LPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIAEIGAS

                     LIKHW"

     promoter        complement(2379..2483)

                     /gene="bla"

                     /label=AmpR promoter

     terminator      2574..2660

                     /gene="Escherichia coli rrnB"

                     /label=rrnB T1 terminator

                     /note="transcription terminator T1 from the E. coli rrnB 

                     gene"

     terminator      2752..2779

                     /label=rrnB T2 terminator

                     /note="transcription terminator T2 from the E. coli rrnB 

                     gene"

ORIGIN

        1 agattgcagc attacacgtc ttgagcgatt gtgtaggctg gagctgcttc gaagttccta

       61 tactttctag agaataggaa cttcggaata ggaacttcat ttaaatggcg cgccttacgc

      121 cccgccctgc cactcatcgc agtactgttg taattcatta agcattctgc cgacatggaa

      181 gccatcacaa acggcatgat gaacctgaat cgccagcggc atcagcacct tgtcgccttg

      241 cgtataatat ttgcccatgg tgaaaacggg ggcgaagaag ttgtccatat tggccacgtt

      301 taaatcaaaa ctggtgaaac tcacccaggg attggctgag acgaaaaaca tattctcaat

      361 aaacccttta gggaaatagg ccaggttttc accgtaacac gccacatctt gcgaatatat

      421 gtgtagaaac tgccggaaat cgtcgtggta ttcactccag agcgatgaaa acgtttcagt

      481 ttgctcatgg aaaacggtgt aacaagggtg aacactatcc catatcacca gctcaccgtc

      541 tttcattgcc atacgtaatt ccggatgagc attcatcagg cgggcaagaa tgtgaataaa

      601 ggccggataa aacttgtgct tatttttctt tacggtcttt aaaaaggccg taatatccag

      661 ctgaacggtc tggttatagg tacattgagc aactgactga aatgcctcaa aatgttcttt

      721 acgatgccat tgggatatat caacggtggt atatccagtg atttttttct ccattttagc

      781 ttccttagct cctgaaaatc tcgacaactc aaaaaatacg cccggtagtg atcttatttc

      841 attatggtga aagttggaac ctcttacgtg ccgatcaacg tctcattttc gccaaaagtt

      901 ggcccagggc ttcccggtat caacagggac accaggattt atttattctg cgaagtgatc

      961 ttccgtcaca ggtaggcgcg ccgaagttcc tatactttct agagaatagg aacttcggaa

     1021 taggaactaa ggaggatatt catatggacc atggctaatt cccatgtcag ccgttaagtg

     1081 ttcctgtgtc actgaaaatt gctttgagag gctctaaggg cttctcagtg cgttacatcc

     1141 ctggcttgtt gtccacaacc gttaaacctt aaaagcttta aaagccttat atattctttt

     1201 ttttcttata aaacttaaaa ccttagaggc tatttaagtt gctgatttat attaatttta

     1261 ttgttcaaac atgagagctt agtacgtgaa acatgagagc ttagtacgtt agccatgaga

     1321 gcttagtacg ttagccatga gggtttagtt cgttaaacat gagagcttag tacgttaaac

     1381 atgagagctt agtacgtgaa acatgagagc ttagtacgta ctatcaacag gttgaactgc

     1441 ggatcttgcg gccgcaaaaa ttaaaaatga agttttaaat caatctaaag tatatatgag

     1501 taaacttggt ctgacagtta ccaatgctta atcagtgagg cacctatctc agcgatctgt

     1561 ctatttcgtt catccatagt tgcctgactc cccgtcgtgt agataactac gatacgggag

     1621 ggcttaccat ctggccccag tgctgcaatg ataccgcgag acccacgctc accggctcca

     1681 gatttatcag caataaacca gccagccgga agggccgagc gcagaagtgg tcctgcaact

     1741 ttatccgcct ccatccagtc tattaattgt tgccgggaag ctagagtaag tagttcgcca

     1801 gttaatagtt tgcgcaacgt tgttgccatt gctacaggca tcgtggtgtc acgctcgtcg

     1861 tttggtatgg cttcattcag ctccggttcc caacgatcaa ggcgagttac atgatccccc

     1921 atgttgtgca aaaaagcggt tagctccttc ggtcctccga tcgttgtcag aagtaagttg

     1981 gccgcagtgt tatcactcat ggttatggca gcactgcata attctcttac tgtcatgcca

     2041 tccgtaagat gcttttctgt gactggtgag tactcaacca agtcattctg agaatagtgt

     2101 atgcggcgac cgagttgctc ttgcccggcg tcaatacggg ataataccgc gccacatagc

     2161 agaactttaa aagtgctcat cattggaaaa cgttcttcgg ggcgaaaact ctcaaggatc

     2221 ttaccgctgt tgagatccag ttcgatgtaa cccactcgtg cacccaactg atcttcagca

     2281 tcttttactt tcaccagcgt ttctgggtga gcaaaaacag gaaggcaaaa tgccgcaaaa

     2341 aagggaataa gggcgacacg gaaatgttga atactcatac tcttcctttt tcaatattat

     2401 tgaagcattt atcagggtta ttgtctcatg agcggataca tatttgaatg tatttagaaa

     2461 aataaacaaa taggggttcc gcgcacattt ccccgaaaag tgccacctgc atcgatggcc

     2521 ccccgatggt agtgtggggt ctccccatgc gagagtaggg aactgccagg catcaaataa

     2581 aacgaaaggc tcagtcgaaa gactgggcct ttcgttttat ctgttgtttg tcggtgaacg

     2641 ctctcctgag taggacaaat ccgccgggag cggatttgaa cgttgcgaag caacggcccg

     2701 gagggtggcg ggcaggacgc ccgccataaa ctgccaggca tcaaattaag cagaaggcca

     2761 tcctgacgga tggccttttt gcgtggccag tgccaagctt gcatgc

//

 

Caution:
Product is for research use only!

 

Search name

pKD3,Plasmid pKD3,pKD3 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart