pKD4

$216.00

  • Model: PVT6002
  • 50 Units in Stock
Ask a question


Add to Cart:

pKD4

PVT6002    2ug
 

pKD4 Plasmid Information

Carrier name: pKD4
Plasmid type: bacterial expression; gene knockout system
High copy / low copy: -
Promoter: -
Cloning methods: multiple cloning sites, restriction endonucleases
Carrier size: 3267 BP
Primers and sequences of 5'sequencing: Amp-R: ATAATACCGCGCCACATAGC
Primers and sequences of 3'sequencing: -
Carrier Tags: -
Carrier resistance: ampicillin 
Screening marker: neomycin 
Use:Homologous recombination HR plasmid
 

pKD4 Plasmid Sequence

 

  LOCUS       pKD4 3267 bp  DNA SYN  DEFINITION  pKD4  ACCESSION     KEYWORDS      SOURCE          ORGANISM  other sequences; artificial sequences; vectors.  FEATURES             Location/Qualifiers       source          1..3267                       /organism="pKD4"                       /mol_type="other DNA"       misc_feature    complement(51..98)                       /label="FRT"       promoter        321..370                       /label="NEOKAN_promoter"       CDS             459..1253                       /label="ORF frame 3"                       /translation="MIEQDGLHAGSPAAWVERLFGYDWAQQTIGCSDAAVFRLSAQGR                       PVLFVKTDLSGALNELQDEAARLSWLATTGVPCAAVLDVVTEAGRDWLLLGEVPGQDL                       LSSHLAPAEKVSIMADAMRRLHTLDPATCPFDHQAKHRIERARTRMEAGLVDQDDLDE                       EHQGLAPAELFARLKARMPDGEDLVVTHGDACLPNIMVENGRFSGFIDCGRLGVADRY                       QDIALATRDIAEELGGEWADRFLVLYGIAAPDSQRIAFYRLLDEFF*"       CDS             complement(768..1304)                       /label="ORF frame 2"                       /translation="MAGWASLGRSFRTPESRSEELVKKAIEGDALRIGSGDTVKHEEA                       VSPFAAKLFSNITGSQRYVLIAVRHTQPATVDESRKAAIFHHDIRQAGIAMGHDEILA                       VGHARLEPGEQFGWREPLMLFVQIILIDKTGFHPSTCSLDAMFRLVVEWAGSRIKRMQ                       PPHCISHDGYFLGRSKVR*"       misc_feature    1882..1900                       /label="pUni_fwd_primer"                       /translation="MAGWASLGRSFRTPESRSEELVKKAIEGDALRIGSGDTVKHEEA                       VSPFAAKLFSNITGSQRYVLIAVRHTQPATVDESRKAAIFHHDIRQAGIAMGHDEILA                       VGHARLEPGEQFGWREPLMLFVQIILIDKTGFHPSTCSLDAMFRLVVEWAGSRIKRMQ                       PPHCISHDGYFLGRSKVR*"       gene            complement(1979..2839)                       /label="Ampicillin"                       /gene="Ampicillin"                       /translation="MAGWASLGRSFRTPESRSEELVKKAIEGDALRIGSGDTVKHEEA                       VSPFAAKLFSNITGSQRYVLIAVRHTQPATVDESRKAAIFHHDIRQAGIAMGHDEILA                       VGHARLEPGEQFGWREPLMLFVQIILIDKTGFHPSTCSLDAMFRLVVEWAGSRIKRMQ                       PPHCISHDGYFLGRSKVR*"       CDS             complement(1979..2839)                       /label="ORF frame 3"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       promoter        complement(2881..2909)                       /label="AmpR_promoter"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       terminator      3038..3081                       /label="rrnB_T1_terminator"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"       terminator      3213..3240                       /label="rrnB_T2_terminator"                       /translation="MSIQHFRVALIPFFAAFCLPVFAHPETLVKVKDAEDQLGARVGY                       IELDLNSGKILESFRPEERFPMMSTFKVLLCGAVLSRIDAGQEQLGRRIHYSQNDLVE                       YSPVTEKHLTDGMTVRELCSAAITMSDNTAANLLLTTIGGPKELTAFLHNMGDHVTRL                       DRWEPELNEAIPNDERDTTMPVAMATTLRKLLTGELLTLASRQQLIDWMEADKVAGPL                       LRSALPAGWFIADKSGAGERGSRGIIAALGPDGKPSRIVVIYTTGSQATMDERNRQIA                       EIGASLIKHW*"  ORIGIN      1 agattgcagc attacacgtc ttgagcgatt gtgtaggctg gagctgcttc gaagttccta     61 tactttctag agaataggaa cttcggaata ggaacttcaa gatcccctca cgctgccgca    121 agcactcagg gcgcaagggc tgctaaagga agcggaacac gtagaaagcc agtccgcaga    181 aacggtgctg accccggatg aatgtcagct actgggctat ctggacaagg gaaaacgcaa    241 gcgcaaagag aaagcaggta gcttgcagtg ggcttacatg gcgatagcta gactgggcgg    301 ttttatggac agcaagcgaa ccggaattgc cagctggggc gccctctggt aaggttggga    361 agccctgcaa agtaaactgg atggctttct tgccgccaag gatctgatgg cgcaggggat    421 caagatctga tcaagagaca ggatgaggat cgtttcgcat gattgaacaa gatggattgc    481 acgcaggttc tccggccgct tgggtggaga ggctattcgg ctatgactgg gcacaacaga    541 caatcggctg ctctgatgcc gccgtgttcc ggctgtcagc gcaggggcgc ccggttcttt    601 ttgtcaagac cgacctgtcc ggtgccctga atgaactgca ggacgaggca gcgcggctat    661 cgtggctggc cacgacgggc gttccttgcg cagctgtgct cgacgttgtc actgaagcgg    721 gaagggactg gctgctattg ggcgaagtgc cggggcagga tctcctgtca tctcaccttg    781 ctcctgccga gaaagtatcc atcatggctg atgcaatgcg gcggctgcat acgcttgatc    841 cggctacctg cccattcgac caccaagcga aacatcgcat cgagcgagca cgtactcgga    901 tggaagccgg tcttgtcgat caggatgatc tggacgaaga gcatcagggg ctcgcgccag    961 ccgaactgtt cgccaggctc aaggcgcgca tgcccgacgg cgaggatctc gtcgtgaccc   1021 atggcgatgc ctgcttgccg aatatcatgg tggaaaatgg ccgcttttct ggattcatcg   1081 actgtggccg gctgggtgtg gcggaccgct atcaggacat agcgttggct acccgtgata   1141 ttgctgaaga gcttggcggc gaatgggctg accgcttcct cgtgctttac ggtatcgccg   1201 ctcccgattc gcagcgcatc gccttctatc gccttcttga cgagttcttc tgagcgggac   1261 tctggggttc gaaatgaccg accaagcgac gcccaacctg ccatcacgag atttcgattc   1321 caccgccgcc ttctatgaaa ggttgggctt cggaatcgtt ttccgggacg ccggctggat   1381 gatcctccag cgcggggatc tcatgctgga gttcttcgcc caccccagct tcaaaagcgc   1441 tctgaagttc ctatactttc tagagaatag gaacttcgga ataggaacta aggaggatat   1501 tcatatggac catggctaat tcccatgtca gccgttaagt gttcctgtgt cactgaaaat   1561 tgctttgaga ggctctaagg gcttctcagt gcgttacatc cctggcttgt tgtccacaac   1621 cgttaaacct taaaagcttt aaaagcctta tatattcttt tttttcttat aaaacttaaa   1681 accttagagg ctatttaagt tgctgattta tattaatttt attgttcaaa catgagagct   1741 tagtacgtga aacatgagag cttagtacgt tagccatgag agcttagtac gttagccatg   1801 agggtttagt tcgttaaaca tgagagctta gtacgttaaa catgagagct tagtacgtga   1861 aacatgagag cttagtacgt actatcaaca ggttgaactg cggatcttgc ggccgcaaaa   1921 attaaaaatg aagttttaaa tcaatctaaa gtatatatga gtaaacttgg tctgacagtt   1981 accaatgctt aatcagtgag gcacctatct cagcgatctg tctatttcgt tcatccatag   2041 ttgcctgact ccccgtcgtg tagataacta cgatacggga gggcttacca tctggcccca   2101 gtgctgcaat gataccgcga gacccacgct caccggctcc agatttatca gcaataaacc   2161 agccagccgg aagggccgag cgcagaagtg gtcctgcaac tttatccgcc tccatccagt   2221 ctattaattg ttgccgggaa gctagagtaa gtagttcgcc agttaatagt ttgcgcaacg   2281 ttgttgccat tgctacaggc atcgtggtgt cacgctcgtc gtttggtatg gcttcattca   2341 gctccggttc ccaacgatca aggcgagtta catgatcccc catgttgtgc aaaaaagcgg   2401 ttagctcctt cggtcctccg atcgttgtca gaagtaagtt ggccgcagtg ttatcactca   2461 tggttatggc agcactgcat aattctctta ctgtcatgcc atccgtaaga tgcttttctg   2521 tgactggtga gtactcaacc aagtcattct gagaatagtg tatgcggcga ccgagttgct   2581 cttgcccggc gtcaatacgg gataataccg cgccacatag cagaacttta aaagtgctca   2641 tcattggaaa acgttcttcg gggcgaaaac tctcaaggat cttaccgctg ttgagatcca   2701 gttcgatgta acccactcgt gcacccaact gatcttcagc atcttttact ttcaccagcg   2761 tttctgggtg agcaaaaaca ggaaggcaaa atgccgcaaa aaagggaata agggcgacac   2821 ggaaatgttg aatactcata ctcttccttt ttcaatatta ttgaagcatt tatcagggtt   2881 attgtctcat gagcggatac atatttgaat gtatttagaa aaataaacaa ataggggttc   2941 cgcgcacatt tccccgaaaa gtgccacctg catcgatggc cccccgatgg tagtgtgggg   3001 tctccccatg cgagagtagg gaactgccag gcatcaaata aaacgaaagg ctcagtcgaa   3061 agactgggcc tttcgtttta tctgttgttt gtcggtgaac gctctcctga gtaggacaaa   3121 tccgccggga gcggatttga acgttgcgaa gcaacggccc ggagggtggc gggcaggacg   3181 cccgccataa actgccaggc atcaaattaa gcagaaggcc atcctgacgg atggcctttt   3241 tgcgtggcca gtgccaagct tgcatgc  //

Caution:
Product is for research use only!

 

Search name

pKD4,Plasmid pKD4,pKD4 vector

No customer comments for the moment.

Add A Comment

Related Products

Cart  

No products

Total $0.00

Prices don't include postage.

Cart